From 085682d70f8d8bd39f3eeb8fc33a62e1307faa7c Mon Sep 17 00:00:00 2001 From: tyler Date: Fri, 12 Apr 2024 13:11:16 -0400 Subject: [PATCH] Included page name in chat info; added test for ChatInfo --- chat.go | 71 +- chat_test.go | 46 + go.mod | 8 +- go.sum | 26 +- vendor/golang.org/x/net/AUTHORS | 3 - vendor/golang.org/x/net/CONTRIBUTORS | 3 - vendor/golang.org/x/net/context/context.go | 6 +- vendor/golang.org/x/net/context/go17.go | 16 +- vendor/golang.org/x/net/context/go19.go | 2 +- vendor/golang.org/x/net/context/pre_go17.go | 12 +- vendor/golang.org/x/net/context/pre_go19.go | 2 +- vendor/golang.org/x/net/html/atom/atom.go | 78 + vendor/golang.org/x/net/html/atom/table.go | 783 +++ vendor/golang.org/x/net/html/const.go | 111 + vendor/golang.org/x/net/html/doc.go | 127 + vendor/golang.org/x/net/html/doctype.go | 156 + vendor/golang.org/x/net/html/entity.go | 2253 ++++++++ vendor/golang.org/x/net/html/escape.go | 339 ++ vendor/golang.org/x/net/html/foreign.go | 222 + vendor/golang.org/x/net/html/node.go | 225 + vendor/golang.org/x/net/html/parse.go | 2460 +++++++++ vendor/golang.org/x/net/html/render.go | 293 ++ vendor/golang.org/x/net/html/token.go | 1272 +++++ .../x/text/feature/plural/tables.go | 2 +- .../internal/language/compact/language.go | 2 +- .../text/internal/language/compact/tables.go | 356 +- .../x/text/internal/language/language.go | 2 +- .../x/text/internal/language/tables.go | 4682 +++++++++-------- .../x/text/internal/number/decimal.go | 2 +- .../x/text/internal/number/tables.go | 2 +- vendor/golang.org/x/text/language/language.go | 2 +- vendor/golang.org/x/text/language/match.go | 2 +- vendor/golang.org/x/text/language/tables.go | 146 +- .../golang.org/x/text/message/catalog/go19.go | 1 - .../x/text/message/catalog/gopre19.go | 1 - vendor/golang.org/x/text/number/option.go | 2 +- vendor/modules.txt | 18 +- 37 files changed, 11053 insertions(+), 2681 deletions(-) create mode 100644 chat_test.go delete mode 100644 vendor/golang.org/x/net/AUTHORS delete mode 100644 vendor/golang.org/x/net/CONTRIBUTORS create mode 100644 vendor/golang.org/x/net/html/atom/atom.go create mode 100644 vendor/golang.org/x/net/html/atom/table.go create mode 100644 vendor/golang.org/x/net/html/const.go create mode 100644 vendor/golang.org/x/net/html/doc.go create mode 100644 vendor/golang.org/x/net/html/doctype.go create mode 100644 vendor/golang.org/x/net/html/entity.go create mode 100644 vendor/golang.org/x/net/html/escape.go create mode 100644 vendor/golang.org/x/net/html/foreign.go create mode 100644 vendor/golang.org/x/net/html/node.go create mode 100644 vendor/golang.org/x/net/html/parse.go create mode 100644 vendor/golang.org/x/net/html/render.go create mode 100644 vendor/golang.org/x/net/html/token.go diff --git a/chat.go b/chat.go index 40a31a5..18d4491 100644 --- a/chat.go +++ b/chat.go @@ -7,6 +7,7 @@ import ( "encoding/csv" "encoding/json" "fmt" + "io" "net/http" "strconv" "strings" @@ -14,13 +15,15 @@ import ( "github.com/r3labs/sse/v2" "github.com/tylertravisty/go-utils/random" + "golang.org/x/net/html" "gopkg.in/cenkalti/backoff.v1" ) type ChatInfo struct { - UrlPrefix string - ChatID string ChannelID int + ChatID string + Page string + UrlPrefix string } func (ci *ChatInfo) MessageUrl() string { @@ -31,14 +34,19 @@ func (ci *ChatInfo) StreamUrl() string { return fmt.Sprintf("%s/chat/%s/stream", ci.UrlPrefix, ci.ChatID) } -func (c *Client) ChatInfo() error { - ci, err := c.getChatInfo() - if err != nil { - return pkgErr("error getting chat info", err) +func (c *Client) ChatInfo(reload bool) (*ChatInfo, error) { + var ci *ChatInfo + var err error + + if c.chatInfo == nil || reload { + ci, err = c.getChatInfo() + if err != nil { + return nil, pkgErr("error getting chat info", err) + } } c.chatInfo = ci - return nil + return ci, nil } func (c *Client) getChatInfo() (*ChatInfo, error) { @@ -52,12 +60,11 @@ func (c *Client) getChatInfo() (*ChatInfo, error) { } defer resp.Body.Close() + var chatInfo *ChatInfo + var page string r := bufio.NewReader(resp.Body) - //line, _, err := r.ReadLine() lineS, err := r.ReadString('\n') - //var lineS string for err == nil { - //lineS = string(line) if strings.Contains(lineS, "RumbleChat(") { start := strings.Index(lineS, "RumbleChat(") + len("RumbleChat(") if start == -1 { @@ -81,16 +88,33 @@ func (c *Client) getChatInfo() (*ChatInfo, error) { if err != nil { return nil, fmt.Errorf("error converting channel ID argument string to int: %v", err) } - return &ChatInfo{info[0], info[1], channelID}, nil + chatInfo = &ChatInfo{ChannelID: channelID, ChatID: info[1], UrlPrefix: info[0]} + } else if strings.Contains(lineS, "media-by--a") && strings.Contains(lineS, "author") { + r := strings.NewReader(lineS) + node, err := html.Parse(r) + if err != nil { + return nil, fmt.Errorf("error parsing html tag with page name: %v", err) + } + if node.FirstChild != nil && node.FirstChild.LastChild != nil && node.FirstChild.LastChild.FirstChild != nil { + for _, attr := range node.FirstChild.LastChild.FirstChild.Attr { + if attr.Key == "href" { + page = attr.Val + } + } + } } - //line, _, err = r.ReadLine() + lineS, err = r.ReadString('\n') } - if err != nil { + if err != nil && err != io.EOF { return nil, fmt.Errorf("error reading line from stream webpage: %v", err) } + if chatInfo == nil { + return nil, fmt.Errorf("did not find RumbleChat function call") + } - return nil, fmt.Errorf("did not find RumbleChat function call") + chatInfo.Page = page + return chatInfo, nil } type ChatMessage struct { @@ -118,20 +142,17 @@ type ChatResponse struct { Errors []Error `json:"errors"` } -func (c *Client) Chat(asChannel bool, message string) error { +func (c *Client) Chat(message string, channelID *int) error { if c.httpClient == nil { return pkgErr("", fmt.Errorf("http client is nil")) } - // chatInfo, err := c.streamChatInfo() - // if err != nil { - // return pkgErr("error getting stream chat info", err) - // } if c.chatInfo == nil { - err := c.ChatInfo() + ci, err := c.getChatInfo() if err != nil { - return err + return pkgErr("error getting chat info", err) } + c.chatInfo = ci } requestID, err := random.String(32) @@ -145,12 +166,12 @@ func (c *Client) Chat(asChannel bool, message string) error { Text: message, }, Rant: nil, - ChannelID: nil, + ChannelID: channelID, }, } - if asChannel { - body.Data.ChannelID = &c.chatInfo.ChannelID - } + // if asChannel { + // body.Data.ChannelID = &c.chatInfo.ChannelID + // } bodyB, err := json.Marshal(body) if err != nil { diff --git a/chat_test.go b/chat_test.go new file mode 100644 index 0000000..e0c016e --- /dev/null +++ b/chat_test.go @@ -0,0 +1,46 @@ +package rumblelivestreamlib + +import ( + "os" + "testing" +) + +const ( + liveUrlEnvVar = "RUMBLE_LIVE_URL" +) + +func TestMain(m *testing.M) { + exitCode := run(m) + os.Exit(exitCode) +} + +func run(m *testing.M) int { + return m.Run() +} + +func TestChatInfo(t *testing.T) { + url := os.Getenv(liveUrlEnvVar) + if url == "" { + t.Skipf("Set %s to run this test.", liveUrlEnvVar) + } + + client, err := NewClient(NewClientOptions{StreamUrl: url}) + if err != nil { + t.Fatalf("Want NewClient err = nil, got: %v", err) + } + ci, err := client.ChatInfo(false) + if err != nil { + t.Fatalf("Want client.ChatInfo err = nil, got: %v", err) + } + + if ci.ChatID == "" { + t.Fatalf("Want non-empty chat ID") + } + if ci.Page == "" { + t.Fatal("Want non-empty page") + } + t.Log("Page:", ci.Page) + if ci.UrlPrefix == "" { + t.Fatal("Want non-empty url prefix") + } +} diff --git a/go.mod b/go.mod index 1512f58..370d61a 100644 --- a/go.mod +++ b/go.mod @@ -3,18 +3,14 @@ module github.com/tylertravisty/rumble-livestream-lib-go go 1.19 require ( - github.com/juju/persistent-cookiejar v1.0.0 github.com/r3labs/sse/v2 v2.10.0 github.com/robertkrimen/otto v0.2.1 github.com/tylertravisty/go-utils v0.0.0-20230524204414-6893ae548909 + golang.org/x/net v0.24.0 gopkg.in/cenkalti/backoff.v1 v1.1.0 ) require ( - github.com/juju/go4 v0.0.0-20160222163258-40d72ab9641a // indirect - golang.org/x/net v0.0.0-20191116160921-f9c825593386 // indirect - golang.org/x/text v0.4.0 // indirect - gopkg.in/errgo.v1 v1.0.1 // indirect - gopkg.in/retry.v1 v1.0.3 // indirect + golang.org/x/text v0.14.0 // indirect gopkg.in/sourcemap.v1 v1.0.5 // indirect ) diff --git a/go.sum b/go.sum index 1d58ebd..a032982 100644 --- a/go.sum +++ b/go.sum @@ -1,45 +1,27 @@ github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= -github.com/frankban/quicktest v1.2.2 h1:xfmOhhoH5fGPgbEAlhLpJH9p0z/0Qizio9osmvn9IUY= -github.com/frankban/quicktest v1.2.2/go.mod h1:Qh/WofXFeiAFII1aEBu529AtJo6Zg2VHscnEsbBnJ20= -github.com/google/go-cmp v0.2.1-0.20190312032427-6f77996f0c42 h1:q3pnF5JFBNRz8sRD+IRj7Y6DMyYGTNqnZ9axTbSfoNI= -github.com/google/go-cmp v0.2.1-0.20190312032427-6f77996f0c42/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU= -github.com/juju/go4 v0.0.0-20160222163258-40d72ab9641a h1:45JtCyuNYE+QN9aPuR1ID9++BQU+NMTMudHSuaK0Las= -github.com/juju/go4 v0.0.0-20160222163258-40d72ab9641a/go.mod h1:RVHtZuvrpETIepiNUrNlih2OynoFf1eM6DGC6dloXzk= -github.com/juju/persistent-cookiejar v1.0.0 h1:Ag7+QLzqC2m+OYXy2QQnRjb3gTkEBSZagZ6QozwT3EQ= -github.com/juju/persistent-cookiejar v1.0.0/go.mod h1:zrbmo4nBKaiP/Ez3F67ewkMbzGYfXyMvRtbOfuAwG0w= -github.com/kr/pretty v0.1.0 h1:L/CwN0zerZDmRFUapSPitk6f+Q3+0za1rQkzVuMiMFI= -github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= -github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ= -github.com/kr/text v0.1.0 h1:45sCR5RtlFHMR4UwH9sdQ5TC8v0qDQCHnXt+kaKSTVE= -github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/r3labs/sse/v2 v2.10.0 h1:hFEkLLFY4LDifoHdiCN/LlGBAdVJYsANaLqNYa1l/v0= github.com/r3labs/sse/v2 v2.10.0/go.mod h1:Igau6Whc+F17QUgML1fYe1VPZzTV6EMCnYktEmkNJ7I= github.com/robertkrimen/otto v0.2.1 h1:FVP0PJ0AHIjC+N4pKCG9yCDz6LHNPCwi/GKID5pGGF0= github.com/robertkrimen/otto v0.2.1/go.mod h1:UPwtJ1Xu7JrLcZjNWN8orJaM5n5YEtqL//farB5FlRY= -github.com/rogpeppe/clock v0.0.0-20190514195947-2896927a307a h1:3QH7VyOaaiUHNrA9Se4YQIRkDTCw1EJls9xTUCaCeRM= -github.com/rogpeppe/clock v0.0.0-20190514195947-2896927a307a/go.mod h1:4r5QyqhjIWCcK8DO4KMclc5Iknq5qVBAlbYYzAbUScQ= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= github.com/stretchr/testify v1.8.1 h1:w7B6lhMri9wdJUVmEZPGGhZzrYTPvgJArz7wNPgYKsk= github.com/tylertravisty/go-utils v0.0.0-20230524204414-6893ae548909 h1:xrjIFqzGQXlCrCdMPpW6+SodGFSlrQ3ZNUCr3f5tF1g= github.com/tylertravisty/go-utils v0.0.0-20230524204414-6893ae548909/go.mod h1:2W31Jhs9YSy7y500wsCOW0bcamGi9foQV1CKrfvfTxk= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= -golang.org/x/net v0.0.0-20191116160921-f9c825593386 h1:ktbWvQrW08Txdxno1PiDpSxPXG6ndGsfnJjRRtkM0LQ= golang.org/x/net v0.0.0-20191116160921-f9c825593386/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= +golang.org/x/net v0.24.0 h1:1PcaxkF854Fu3+lvBIx5SYn9wRlBzzcnHZSiaFFAb0w= +golang.org/x/net v0.24.0/go.mod h1:2Q7sJY5mzlzWjKtYUEXSlBWCdyaioyXzRB2RtU8KVE8= golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= -golang.org/x/text v0.4.0 h1:BrVqGRd7+k1DiOgtnFvAkoQEWQvBc25ouMJM6429SFg= -golang.org/x/text v0.4.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= +golang.org/x/text v0.14.0 h1:ScX5w1eTa3QqT8oi6+ziP7dTV1S2+ALU0bI+0zXKWiQ= +golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU= gopkg.in/cenkalti/backoff.v1 v1.1.0 h1:Arh75ttbsvlpVA7WtVpH4u9h6Zl46xuptxqLxPiSo4Y= gopkg.in/cenkalti/backoff.v1 v1.1.0/go.mod h1:J6Vskwqd+OMVJl8C33mmtxTBs2gyzfv7UDAkHu8BrjI= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= -gopkg.in/errgo.v1 v1.0.1 h1:oQFRXzZ7CkBGdm1XZm/EbQYaYNNEElNBOd09M6cqNso= -gopkg.in/errgo.v1 v1.0.1/go.mod h1:3NjfXwocQRYAPTq4/fzX+CwUhPRcR/azYRhj8G+LqMo= -gopkg.in/retry.v1 v1.0.3 h1:a9CArYczAVv6Qs6VGoLMio99GEs7kY9UzSF9+LD+iGs= -gopkg.in/retry.v1 v1.0.3/go.mod h1:FJkXmWiMaAo7xB+xhvDF59zhfjDWyzmyAxiT4dB688g= gopkg.in/sourcemap.v1 v1.0.5 h1:inv58fC9f9J3TK2Y2R1NPntXEn3/wjWHkonhIUODNTI= gopkg.in/sourcemap.v1 v1.0.5/go.mod h1:2RlvNNSMglmRrcvhfuzp4hQHwOtjxlbjX7UPY/GXb78= gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= diff --git a/vendor/golang.org/x/net/AUTHORS b/vendor/golang.org/x/net/AUTHORS deleted file mode 100644 index 15167cd..0000000 --- a/vendor/golang.org/x/net/AUTHORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code refers to The Go Authors for copyright purposes. -# The master list of authors is in the main Go distribution, -# visible at http://tip.golang.org/AUTHORS. diff --git a/vendor/golang.org/x/net/CONTRIBUTORS b/vendor/golang.org/x/net/CONTRIBUTORS deleted file mode 100644 index 1c4577e..0000000 --- a/vendor/golang.org/x/net/CONTRIBUTORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code was written by the Go contributors. -# The master list of contributors is in the main Go distribution, -# visible at http://tip.golang.org/CONTRIBUTORS. diff --git a/vendor/golang.org/x/net/context/context.go b/vendor/golang.org/x/net/context/context.go index a3c021d..cf66309 100644 --- a/vendor/golang.org/x/net/context/context.go +++ b/vendor/golang.org/x/net/context/context.go @@ -21,9 +21,9 @@ // explicitly to each function that needs it. The Context should be the first // parameter, typically named ctx: // -// func DoSomething(ctx context.Context, arg Arg) error { -// // ... use ctx ... -// } +// func DoSomething(ctx context.Context, arg Arg) error { +// // ... use ctx ... +// } // // Do not pass a nil Context, even if a function permits it. Pass context.TODO // if you are unsure about which Context to use. diff --git a/vendor/golang.org/x/net/context/go17.go b/vendor/golang.org/x/net/context/go17.go index d20f52b..0c1b867 100644 --- a/vendor/golang.org/x/net/context/go17.go +++ b/vendor/golang.org/x/net/context/go17.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// +build go1.7 +//go:build go1.7 package context @@ -31,7 +31,7 @@ var DeadlineExceeded = context.DeadlineExceeded // call cancel as soon as the operations running in this Context complete. func WithCancel(parent Context) (ctx Context, cancel CancelFunc) { ctx, f := context.WithCancel(parent) - return ctx, CancelFunc(f) + return ctx, f } // WithDeadline returns a copy of the parent context with the deadline adjusted @@ -45,7 +45,7 @@ func WithCancel(parent Context) (ctx Context, cancel CancelFunc) { // call cancel as soon as the operations running in this Context complete. func WithDeadline(parent Context, deadline time.Time) (Context, CancelFunc) { ctx, f := context.WithDeadline(parent, deadline) - return ctx, CancelFunc(f) + return ctx, f } // WithTimeout returns WithDeadline(parent, time.Now().Add(timeout)). @@ -53,11 +53,11 @@ func WithDeadline(parent Context, deadline time.Time) (Context, CancelFunc) { // Canceling this context releases resources associated with it, so code should // call cancel as soon as the operations running in this Context complete: // -// func slowOperationWithTimeout(ctx context.Context) (Result, error) { -// ctx, cancel := context.WithTimeout(ctx, 100*time.Millisecond) -// defer cancel() // releases resources if slowOperation completes before timeout elapses -// return slowOperation(ctx) -// } +// func slowOperationWithTimeout(ctx context.Context) (Result, error) { +// ctx, cancel := context.WithTimeout(ctx, 100*time.Millisecond) +// defer cancel() // releases resources if slowOperation completes before timeout elapses +// return slowOperation(ctx) +// } func WithTimeout(parent Context, timeout time.Duration) (Context, CancelFunc) { return WithDeadline(parent, time.Now().Add(timeout)) } diff --git a/vendor/golang.org/x/net/context/go19.go b/vendor/golang.org/x/net/context/go19.go index d88bd1d..e31e35a 100644 --- a/vendor/golang.org/x/net/context/go19.go +++ b/vendor/golang.org/x/net/context/go19.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// +build go1.9 +//go:build go1.9 package context diff --git a/vendor/golang.org/x/net/context/pre_go17.go b/vendor/golang.org/x/net/context/pre_go17.go index 0f35592..065ff3d 100644 --- a/vendor/golang.org/x/net/context/pre_go17.go +++ b/vendor/golang.org/x/net/context/pre_go17.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// +build !go1.7 +//go:build !go1.7 package context @@ -263,11 +263,11 @@ func (c *timerCtx) cancel(removeFromParent bool, err error) { // Canceling this context releases resources associated with it, so code should // call cancel as soon as the operations running in this Context complete: // -// func slowOperationWithTimeout(ctx context.Context) (Result, error) { -// ctx, cancel := context.WithTimeout(ctx, 100*time.Millisecond) -// defer cancel() // releases resources if slowOperation completes before timeout elapses -// return slowOperation(ctx) -// } +// func slowOperationWithTimeout(ctx context.Context) (Result, error) { +// ctx, cancel := context.WithTimeout(ctx, 100*time.Millisecond) +// defer cancel() // releases resources if slowOperation completes before timeout elapses +// return slowOperation(ctx) +// } func WithTimeout(parent Context, timeout time.Duration) (Context, CancelFunc) { return WithDeadline(parent, time.Now().Add(timeout)) } diff --git a/vendor/golang.org/x/net/context/pre_go19.go b/vendor/golang.org/x/net/context/pre_go19.go index b105f80..ec5a638 100644 --- a/vendor/golang.org/x/net/context/pre_go19.go +++ b/vendor/golang.org/x/net/context/pre_go19.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// +build !go1.9 +//go:build !go1.9 package context diff --git a/vendor/golang.org/x/net/html/atom/atom.go b/vendor/golang.org/x/net/html/atom/atom.go new file mode 100644 index 0000000..cd0a8ac --- /dev/null +++ b/vendor/golang.org/x/net/html/atom/atom.go @@ -0,0 +1,78 @@ +// Copyright 2012 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package atom provides integer codes (also known as atoms) for a fixed set of +// frequently occurring HTML strings: tag names and attribute keys such as "p" +// and "id". +// +// Sharing an atom's name between all elements with the same tag can result in +// fewer string allocations when tokenizing and parsing HTML. Integer +// comparisons are also generally faster than string comparisons. +// +// The value of an atom's particular code is not guaranteed to stay the same +// between versions of this package. Neither is any ordering guaranteed: +// whether atom.H1 < atom.H2 may also change. The codes are not guaranteed to +// be dense. The only guarantees are that e.g. looking up "div" will yield +// atom.Div, calling atom.Div.String will return "div", and atom.Div != 0. +package atom // import "golang.org/x/net/html/atom" + +// Atom is an integer code for a string. The zero value maps to "". +type Atom uint32 + +// String returns the atom's name. +func (a Atom) String() string { + start := uint32(a >> 8) + n := uint32(a & 0xff) + if start+n > uint32(len(atomText)) { + return "" + } + return atomText[start : start+n] +} + +func (a Atom) string() string { + return atomText[a>>8 : a>>8+a&0xff] +} + +// fnv computes the FNV hash with an arbitrary starting value h. +func fnv(h uint32, s []byte) uint32 { + for i := range s { + h ^= uint32(s[i]) + h *= 16777619 + } + return h +} + +func match(s string, t []byte) bool { + for i, c := range t { + if s[i] != c { + return false + } + } + return true +} + +// Lookup returns the atom whose name is s. It returns zero if there is no +// such atom. The lookup is case sensitive. +func Lookup(s []byte) Atom { + if len(s) == 0 || len(s) > maxAtomLen { + return 0 + } + h := fnv(hash0, s) + if a := table[h&uint32(len(table)-1)]; int(a&0xff) == len(s) && match(a.string(), s) { + return a + } + if a := table[(h>>16)&uint32(len(table)-1)]; int(a&0xff) == len(s) && match(a.string(), s) { + return a + } + return 0 +} + +// String returns a string whose contents are equal to s. In that sense, it is +// equivalent to string(s) but may be more efficient. +func String(s []byte) string { + if a := Lookup(s); a != 0 { + return a.String() + } + return string(s) +} diff --git a/vendor/golang.org/x/net/html/atom/table.go b/vendor/golang.org/x/net/html/atom/table.go new file mode 100644 index 0000000..2a93886 --- /dev/null +++ b/vendor/golang.org/x/net/html/atom/table.go @@ -0,0 +1,783 @@ +// Code generated by go generate gen.go; DO NOT EDIT. + +//go:generate go run gen.go + +package atom + +const ( + A Atom = 0x1 + Abbr Atom = 0x4 + Accept Atom = 0x1a06 + AcceptCharset Atom = 0x1a0e + Accesskey Atom = 0x2c09 + Acronym Atom = 0xaa07 + Action Atom = 0x27206 + Address Atom = 0x6f307 + Align Atom = 0xb105 + Allowfullscreen Atom = 0x2080f + Allowpaymentrequest Atom = 0xc113 + Allowusermedia Atom = 0xdd0e + Alt Atom = 0xf303 + Annotation Atom = 0x1c90a + AnnotationXml Atom = 0x1c90e + Applet Atom = 0x31906 + Area Atom = 0x35604 + Article Atom = 0x3fc07 + As Atom = 0x3c02 + Aside Atom = 0x10705 + Async Atom = 0xff05 + Audio Atom = 0x11505 + Autocomplete Atom = 0x2780c + Autofocus Atom = 0x12109 + Autoplay Atom = 0x13c08 + B Atom = 0x101 + Base Atom = 0x3b04 + Basefont Atom = 0x3b08 + Bdi Atom = 0xba03 + Bdo Atom = 0x14b03 + Bgsound Atom = 0x15e07 + Big Atom = 0x17003 + Blink Atom = 0x17305 + Blockquote Atom = 0x1870a + Body Atom = 0x2804 + Br Atom = 0x202 + Button Atom = 0x19106 + Canvas Atom = 0x10306 + Caption Atom = 0x23107 + Center Atom = 0x22006 + Challenge Atom = 0x29b09 + Charset Atom = 0x2107 + Checked Atom = 0x47907 + Cite Atom = 0x19c04 + Class Atom = 0x56405 + Code Atom = 0x5c504 + Col Atom = 0x1ab03 + Colgroup Atom = 0x1ab08 + Color Atom = 0x1bf05 + Cols Atom = 0x1c404 + Colspan Atom = 0x1c407 + Command Atom = 0x1d707 + Content Atom = 0x58b07 + Contenteditable Atom = 0x58b0f + Contextmenu Atom = 0x3800b + Controls Atom = 0x1de08 + Coords Atom = 0x1ea06 + Crossorigin Atom = 0x1fb0b + Data Atom = 0x4a504 + Datalist Atom = 0x4a508 + Datetime Atom = 0x2b808 + Dd Atom = 0x2d702 + Default Atom = 0x10a07 + Defer Atom = 0x5c705 + Del Atom = 0x45203 + Desc Atom = 0x56104 + Details Atom = 0x7207 + Dfn Atom = 0x8703 + Dialog Atom = 0xbb06 + Dir Atom = 0x9303 + Dirname Atom = 0x9307 + Disabled Atom = 0x16408 + Div Atom = 0x16b03 + Dl Atom = 0x5e602 + Download Atom = 0x46308 + Draggable Atom = 0x17a09 + Dropzone Atom = 0x40508 + Dt Atom = 0x64b02 + Em Atom = 0x6e02 + Embed Atom = 0x6e05 + Enctype Atom = 0x28d07 + Face Atom = 0x21e04 + Fieldset Atom = 0x22608 + Figcaption Atom = 0x22e0a + Figure Atom = 0x24806 + Font Atom = 0x3f04 + Footer Atom = 0xf606 + For Atom = 0x25403 + ForeignObject Atom = 0x2540d + Foreignobject Atom = 0x2610d + Form Atom = 0x26e04 + Formaction Atom = 0x26e0a + Formenctype Atom = 0x2890b + Formmethod Atom = 0x2a40a + Formnovalidate Atom = 0x2ae0e + Formtarget Atom = 0x2c00a + Frame Atom = 0x8b05 + Frameset Atom = 0x8b08 + H1 Atom = 0x15c02 + H2 Atom = 0x2de02 + H3 Atom = 0x30d02 + H4 Atom = 0x34502 + H5 Atom = 0x34f02 + H6 Atom = 0x64d02 + Head Atom = 0x33104 + Header Atom = 0x33106 + Headers Atom = 0x33107 + Height Atom = 0x5206 + Hgroup Atom = 0x2ca06 + Hidden Atom = 0x2d506 + High Atom = 0x2db04 + Hr Atom = 0x15702 + Href Atom = 0x2e004 + Hreflang Atom = 0x2e008 + Html Atom = 0x5604 + HttpEquiv Atom = 0x2e80a + I Atom = 0x601 + Icon Atom = 0x58a04 + Id Atom = 0x10902 + Iframe Atom = 0x2fc06 + Image Atom = 0x30205 + Img Atom = 0x30703 + Input Atom = 0x44b05 + Inputmode Atom = 0x44b09 + Ins Atom = 0x20403 + Integrity Atom = 0x23f09 + Is Atom = 0x16502 + Isindex Atom = 0x30f07 + Ismap Atom = 0x31605 + Itemid Atom = 0x38b06 + Itemprop Atom = 0x19d08 + Itemref Atom = 0x3cd07 + Itemscope Atom = 0x67109 + Itemtype Atom = 0x31f08 + Kbd Atom = 0xb903 + Keygen Atom = 0x3206 + Keytype Atom = 0xd607 + Kind Atom = 0x17704 + Label Atom = 0x5905 + Lang Atom = 0x2e404 + Legend Atom = 0x18106 + Li Atom = 0xb202 + Link Atom = 0x17404 + List Atom = 0x4a904 + Listing Atom = 0x4a907 + Loop Atom = 0x5d04 + Low Atom = 0xc303 + Main Atom = 0x1004 + Malignmark Atom = 0xb00a + Manifest Atom = 0x6d708 + Map Atom = 0x31803 + Mark Atom = 0xb604 + Marquee Atom = 0x32707 + Math Atom = 0x32e04 + Max Atom = 0x33d03 + Maxlength Atom = 0x33d09 + Media Atom = 0xe605 + Mediagroup Atom = 0xe60a + Menu Atom = 0x38704 + Menuitem Atom = 0x38708 + Meta Atom = 0x4b804 + Meter Atom = 0x9805 + Method Atom = 0x2a806 + Mglyph Atom = 0x30806 + Mi Atom = 0x34702 + Min Atom = 0x34703 + Minlength Atom = 0x34709 + Mn Atom = 0x2b102 + Mo Atom = 0xa402 + Ms Atom = 0x67402 + Mtext Atom = 0x35105 + Multiple Atom = 0x35f08 + Muted Atom = 0x36705 + Name Atom = 0x9604 + Nav Atom = 0x1303 + Nobr Atom = 0x3704 + Noembed Atom = 0x6c07 + Noframes Atom = 0x8908 + Nomodule Atom = 0xa208 + Nonce Atom = 0x1a605 + Noscript Atom = 0x21608 + Novalidate Atom = 0x2b20a + Object Atom = 0x26806 + Ol Atom = 0x13702 + Onabort Atom = 0x19507 + Onafterprint Atom = 0x2360c + Onautocomplete Atom = 0x2760e + Onautocompleteerror Atom = 0x27613 + Onauxclick Atom = 0x61f0a + Onbeforeprint Atom = 0x69e0d + Onbeforeunload Atom = 0x6e70e + Onblur Atom = 0x56d06 + Oncancel Atom = 0x11908 + Oncanplay Atom = 0x14d09 + Oncanplaythrough Atom = 0x14d10 + Onchange Atom = 0x41b08 + Onclick Atom = 0x2f507 + Onclose Atom = 0x36c07 + Oncontextmenu Atom = 0x37e0d + Oncopy Atom = 0x39106 + Oncuechange Atom = 0x3970b + Oncut Atom = 0x3a205 + Ondblclick Atom = 0x3a70a + Ondrag Atom = 0x3b106 + Ondragend Atom = 0x3b109 + Ondragenter Atom = 0x3ba0b + Ondragexit Atom = 0x3c50a + Ondragleave Atom = 0x3df0b + Ondragover Atom = 0x3ea0a + Ondragstart Atom = 0x3f40b + Ondrop Atom = 0x40306 + Ondurationchange Atom = 0x41310 + Onemptied Atom = 0x40a09 + Onended Atom = 0x42307 + Onerror Atom = 0x42a07 + Onfocus Atom = 0x43107 + Onhashchange Atom = 0x43d0c + Oninput Atom = 0x44907 + Oninvalid Atom = 0x45509 + Onkeydown Atom = 0x45e09 + Onkeypress Atom = 0x46b0a + Onkeyup Atom = 0x48007 + Onlanguagechange Atom = 0x48d10 + Onload Atom = 0x49d06 + Onloadeddata Atom = 0x49d0c + Onloadedmetadata Atom = 0x4b010 + Onloadend Atom = 0x4c609 + Onloadstart Atom = 0x4cf0b + Onmessage Atom = 0x4da09 + Onmessageerror Atom = 0x4da0e + Onmousedown Atom = 0x4e80b + Onmouseenter Atom = 0x4f30c + Onmouseleave Atom = 0x4ff0c + Onmousemove Atom = 0x50b0b + Onmouseout Atom = 0x5160a + Onmouseover Atom = 0x5230b + Onmouseup Atom = 0x52e09 + Onmousewheel Atom = 0x53c0c + Onoffline Atom = 0x54809 + Ononline Atom = 0x55108 + Onpagehide Atom = 0x5590a + Onpageshow Atom = 0x5730a + Onpaste Atom = 0x57f07 + Onpause Atom = 0x59a07 + Onplay Atom = 0x5a406 + Onplaying Atom = 0x5a409 + Onpopstate Atom = 0x5ad0a + Onprogress Atom = 0x5b70a + Onratechange Atom = 0x5cc0c + Onrejectionhandled Atom = 0x5d812 + Onreset Atom = 0x5ea07 + Onresize Atom = 0x5f108 + Onscroll Atom = 0x60008 + Onsecuritypolicyviolation Atom = 0x60819 + Onseeked Atom = 0x62908 + Onseeking Atom = 0x63109 + Onselect Atom = 0x63a08 + Onshow Atom = 0x64406 + Onsort Atom = 0x64f06 + Onstalled Atom = 0x65909 + Onstorage Atom = 0x66209 + Onsubmit Atom = 0x66b08 + Onsuspend Atom = 0x67b09 + Ontimeupdate Atom = 0x400c + Ontoggle Atom = 0x68408 + Onunhandledrejection Atom = 0x68c14 + Onunload Atom = 0x6ab08 + Onvolumechange Atom = 0x6b30e + Onwaiting Atom = 0x6c109 + Onwheel Atom = 0x6ca07 + Open Atom = 0x1a304 + Optgroup Atom = 0x5f08 + Optimum Atom = 0x6d107 + Option Atom = 0x6e306 + Output Atom = 0x51d06 + P Atom = 0xc01 + Param Atom = 0xc05 + Pattern Atom = 0x6607 + Picture Atom = 0x7b07 + Ping Atom = 0xef04 + Placeholder Atom = 0x1310b + Plaintext Atom = 0x1b209 + Playsinline Atom = 0x1400b + Poster Atom = 0x2cf06 + Pre Atom = 0x47003 + Preload Atom = 0x48607 + Progress Atom = 0x5b908 + Prompt Atom = 0x53606 + Public Atom = 0x58606 + Q Atom = 0xcf01 + Radiogroup Atom = 0x30a + Rb Atom = 0x3a02 + Readonly Atom = 0x35708 + Referrerpolicy Atom = 0x3d10e + Rel Atom = 0x48703 + Required Atom = 0x24c08 + Reversed Atom = 0x8008 + Rows Atom = 0x9c04 + Rowspan Atom = 0x9c07 + Rp Atom = 0x23c02 + Rt Atom = 0x19a02 + Rtc Atom = 0x19a03 + Ruby Atom = 0xfb04 + S Atom = 0x2501 + Samp Atom = 0x7804 + Sandbox Atom = 0x12907 + Scope Atom = 0x67505 + Scoped Atom = 0x67506 + Script Atom = 0x21806 + Seamless Atom = 0x37108 + Section Atom = 0x56807 + Select Atom = 0x63c06 + Selected Atom = 0x63c08 + Shape Atom = 0x1e505 + Size Atom = 0x5f504 + Sizes Atom = 0x5f505 + Slot Atom = 0x1ef04 + Small Atom = 0x20605 + Sortable Atom = 0x65108 + Sorted Atom = 0x33706 + Source Atom = 0x37806 + Spacer Atom = 0x43706 + Span Atom = 0x9f04 + Spellcheck Atom = 0x4740a + Src Atom = 0x5c003 + Srcdoc Atom = 0x5c006 + Srclang Atom = 0x5f907 + Srcset Atom = 0x6f906 + Start Atom = 0x3fa05 + Step Atom = 0x58304 + Strike Atom = 0xd206 + Strong Atom = 0x6dd06 + Style Atom = 0x6ff05 + Sub Atom = 0x66d03 + Summary Atom = 0x70407 + Sup Atom = 0x70b03 + Svg Atom = 0x70e03 + System Atom = 0x71106 + Tabindex Atom = 0x4be08 + Table Atom = 0x59505 + Target Atom = 0x2c406 + Tbody Atom = 0x2705 + Td Atom = 0x9202 + Template Atom = 0x71408 + Textarea Atom = 0x35208 + Tfoot Atom = 0xf505 + Th Atom = 0x15602 + Thead Atom = 0x33005 + Time Atom = 0x4204 + Title Atom = 0x11005 + Tr Atom = 0xcc02 + Track Atom = 0x1ba05 + Translate Atom = 0x1f209 + Tt Atom = 0x6802 + Type Atom = 0xd904 + Typemustmatch Atom = 0x2900d + U Atom = 0xb01 + Ul Atom = 0xa702 + Updateviacache Atom = 0x460e + Usemap Atom = 0x59e06 + Value Atom = 0x1505 + Var Atom = 0x16d03 + Video Atom = 0x2f105 + Wbr Atom = 0x57c03 + Width Atom = 0x64905 + Workertype Atom = 0x71c0a + Wrap Atom = 0x72604 + Xmp Atom = 0x12f03 +) + +const hash0 = 0x81cdf10e + +const maxAtomLen = 25 + +var table = [1 << 9]Atom{ + 0x1: 0xe60a, // mediagroup + 0x2: 0x2e404, // lang + 0x4: 0x2c09, // accesskey + 0x5: 0x8b08, // frameset + 0x7: 0x63a08, // onselect + 0x8: 0x71106, // system + 0xa: 0x64905, // width + 0xc: 0x2890b, // formenctype + 0xd: 0x13702, // ol + 0xe: 0x3970b, // oncuechange + 0x10: 0x14b03, // bdo + 0x11: 0x11505, // audio + 0x12: 0x17a09, // draggable + 0x14: 0x2f105, // video + 0x15: 0x2b102, // mn + 0x16: 0x38704, // menu + 0x17: 0x2cf06, // poster + 0x19: 0xf606, // footer + 0x1a: 0x2a806, // method + 0x1b: 0x2b808, // datetime + 0x1c: 0x19507, // onabort + 0x1d: 0x460e, // updateviacache + 0x1e: 0xff05, // async + 0x1f: 0x49d06, // onload + 0x21: 0x11908, // oncancel + 0x22: 0x62908, // onseeked + 0x23: 0x30205, // image + 0x24: 0x5d812, // onrejectionhandled + 0x26: 0x17404, // link + 0x27: 0x51d06, // output + 0x28: 0x33104, // head + 0x29: 0x4ff0c, // onmouseleave + 0x2a: 0x57f07, // onpaste + 0x2b: 0x5a409, // onplaying + 0x2c: 0x1c407, // colspan + 0x2f: 0x1bf05, // color + 0x30: 0x5f504, // size + 0x31: 0x2e80a, // http-equiv + 0x33: 0x601, // i + 0x34: 0x5590a, // onpagehide + 0x35: 0x68c14, // onunhandledrejection + 0x37: 0x42a07, // onerror + 0x3a: 0x3b08, // basefont + 0x3f: 0x1303, // nav + 0x40: 0x17704, // kind + 0x41: 0x35708, // readonly + 0x42: 0x30806, // mglyph + 0x44: 0xb202, // li + 0x46: 0x2d506, // hidden + 0x47: 0x70e03, // svg + 0x48: 0x58304, // step + 0x49: 0x23f09, // integrity + 0x4a: 0x58606, // public + 0x4c: 0x1ab03, // col + 0x4d: 0x1870a, // blockquote + 0x4e: 0x34f02, // h5 + 0x50: 0x5b908, // progress + 0x51: 0x5f505, // sizes + 0x52: 0x34502, // h4 + 0x56: 0x33005, // thead + 0x57: 0xd607, // keytype + 0x58: 0x5b70a, // onprogress + 0x59: 0x44b09, // inputmode + 0x5a: 0x3b109, // ondragend + 0x5d: 0x3a205, // oncut + 0x5e: 0x43706, // spacer + 0x5f: 0x1ab08, // colgroup + 0x62: 0x16502, // is + 0x65: 0x3c02, // as + 0x66: 0x54809, // onoffline + 0x67: 0x33706, // sorted + 0x69: 0x48d10, // onlanguagechange + 0x6c: 0x43d0c, // onhashchange + 0x6d: 0x9604, // name + 0x6e: 0xf505, // tfoot + 0x6f: 0x56104, // desc + 0x70: 0x33d03, // max + 0x72: 0x1ea06, // coords + 0x73: 0x30d02, // h3 + 0x74: 0x6e70e, // onbeforeunload + 0x75: 0x9c04, // rows + 0x76: 0x63c06, // select + 0x77: 0x9805, // meter + 0x78: 0x38b06, // itemid + 0x79: 0x53c0c, // onmousewheel + 0x7a: 0x5c006, // srcdoc + 0x7d: 0x1ba05, // track + 0x7f: 0x31f08, // itemtype + 0x82: 0xa402, // mo + 0x83: 0x41b08, // onchange + 0x84: 0x33107, // headers + 0x85: 0x5cc0c, // onratechange + 0x86: 0x60819, // onsecuritypolicyviolation + 0x88: 0x4a508, // datalist + 0x89: 0x4e80b, // onmousedown + 0x8a: 0x1ef04, // slot + 0x8b: 0x4b010, // onloadedmetadata + 0x8c: 0x1a06, // accept + 0x8d: 0x26806, // object + 0x91: 0x6b30e, // onvolumechange + 0x92: 0x2107, // charset + 0x93: 0x27613, // onautocompleteerror + 0x94: 0xc113, // allowpaymentrequest + 0x95: 0x2804, // body + 0x96: 0x10a07, // default + 0x97: 0x63c08, // selected + 0x98: 0x21e04, // face + 0x99: 0x1e505, // shape + 0x9b: 0x68408, // ontoggle + 0x9e: 0x64b02, // dt + 0x9f: 0xb604, // mark + 0xa1: 0xb01, // u + 0xa4: 0x6ab08, // onunload + 0xa5: 0x5d04, // loop + 0xa6: 0x16408, // disabled + 0xaa: 0x42307, // onended + 0xab: 0xb00a, // malignmark + 0xad: 0x67b09, // onsuspend + 0xae: 0x35105, // mtext + 0xaf: 0x64f06, // onsort + 0xb0: 0x19d08, // itemprop + 0xb3: 0x67109, // itemscope + 0xb4: 0x17305, // blink + 0xb6: 0x3b106, // ondrag + 0xb7: 0xa702, // ul + 0xb8: 0x26e04, // form + 0xb9: 0x12907, // sandbox + 0xba: 0x8b05, // frame + 0xbb: 0x1505, // value + 0xbc: 0x66209, // onstorage + 0xbf: 0xaa07, // acronym + 0xc0: 0x19a02, // rt + 0xc2: 0x202, // br + 0xc3: 0x22608, // fieldset + 0xc4: 0x2900d, // typemustmatch + 0xc5: 0xa208, // nomodule + 0xc6: 0x6c07, // noembed + 0xc7: 0x69e0d, // onbeforeprint + 0xc8: 0x19106, // button + 0xc9: 0x2f507, // onclick + 0xca: 0x70407, // summary + 0xcd: 0xfb04, // ruby + 0xce: 0x56405, // class + 0xcf: 0x3f40b, // ondragstart + 0xd0: 0x23107, // caption + 0xd4: 0xdd0e, // allowusermedia + 0xd5: 0x4cf0b, // onloadstart + 0xd9: 0x16b03, // div + 0xda: 0x4a904, // list + 0xdb: 0x32e04, // math + 0xdc: 0x44b05, // input + 0xdf: 0x3ea0a, // ondragover + 0xe0: 0x2de02, // h2 + 0xe2: 0x1b209, // plaintext + 0xe4: 0x4f30c, // onmouseenter + 0xe7: 0x47907, // checked + 0xe8: 0x47003, // pre + 0xea: 0x35f08, // multiple + 0xeb: 0xba03, // bdi + 0xec: 0x33d09, // maxlength + 0xed: 0xcf01, // q + 0xee: 0x61f0a, // onauxclick + 0xf0: 0x57c03, // wbr + 0xf2: 0x3b04, // base + 0xf3: 0x6e306, // option + 0xf5: 0x41310, // ondurationchange + 0xf7: 0x8908, // noframes + 0xf9: 0x40508, // dropzone + 0xfb: 0x67505, // scope + 0xfc: 0x8008, // reversed + 0xfd: 0x3ba0b, // ondragenter + 0xfe: 0x3fa05, // start + 0xff: 0x12f03, // xmp + 0x100: 0x5f907, // srclang + 0x101: 0x30703, // img + 0x104: 0x101, // b + 0x105: 0x25403, // for + 0x106: 0x10705, // aside + 0x107: 0x44907, // oninput + 0x108: 0x35604, // area + 0x109: 0x2a40a, // formmethod + 0x10a: 0x72604, // wrap + 0x10c: 0x23c02, // rp + 0x10d: 0x46b0a, // onkeypress + 0x10e: 0x6802, // tt + 0x110: 0x34702, // mi + 0x111: 0x36705, // muted + 0x112: 0xf303, // alt + 0x113: 0x5c504, // code + 0x114: 0x6e02, // em + 0x115: 0x3c50a, // ondragexit + 0x117: 0x9f04, // span + 0x119: 0x6d708, // manifest + 0x11a: 0x38708, // menuitem + 0x11b: 0x58b07, // content + 0x11d: 0x6c109, // onwaiting + 0x11f: 0x4c609, // onloadend + 0x121: 0x37e0d, // oncontextmenu + 0x123: 0x56d06, // onblur + 0x124: 0x3fc07, // article + 0x125: 0x9303, // dir + 0x126: 0xef04, // ping + 0x127: 0x24c08, // required + 0x128: 0x45509, // oninvalid + 0x129: 0xb105, // align + 0x12b: 0x58a04, // icon + 0x12c: 0x64d02, // h6 + 0x12d: 0x1c404, // cols + 0x12e: 0x22e0a, // figcaption + 0x12f: 0x45e09, // onkeydown + 0x130: 0x66b08, // onsubmit + 0x131: 0x14d09, // oncanplay + 0x132: 0x70b03, // sup + 0x133: 0xc01, // p + 0x135: 0x40a09, // onemptied + 0x136: 0x39106, // oncopy + 0x137: 0x19c04, // cite + 0x138: 0x3a70a, // ondblclick + 0x13a: 0x50b0b, // onmousemove + 0x13c: 0x66d03, // sub + 0x13d: 0x48703, // rel + 0x13e: 0x5f08, // optgroup + 0x142: 0x9c07, // rowspan + 0x143: 0x37806, // source + 0x144: 0x21608, // noscript + 0x145: 0x1a304, // open + 0x146: 0x20403, // ins + 0x147: 0x2540d, // foreignObject + 0x148: 0x5ad0a, // onpopstate + 0x14a: 0x28d07, // enctype + 0x14b: 0x2760e, // onautocomplete + 0x14c: 0x35208, // textarea + 0x14e: 0x2780c, // autocomplete + 0x14f: 0x15702, // hr + 0x150: 0x1de08, // controls + 0x151: 0x10902, // id + 0x153: 0x2360c, // onafterprint + 0x155: 0x2610d, // foreignobject + 0x156: 0x32707, // marquee + 0x157: 0x59a07, // onpause + 0x158: 0x5e602, // dl + 0x159: 0x5206, // height + 0x15a: 0x34703, // min + 0x15b: 0x9307, // dirname + 0x15c: 0x1f209, // translate + 0x15d: 0x5604, // html + 0x15e: 0x34709, // minlength + 0x15f: 0x48607, // preload + 0x160: 0x71408, // template + 0x161: 0x3df0b, // ondragleave + 0x162: 0x3a02, // rb + 0x164: 0x5c003, // src + 0x165: 0x6dd06, // strong + 0x167: 0x7804, // samp + 0x168: 0x6f307, // address + 0x169: 0x55108, // ononline + 0x16b: 0x1310b, // placeholder + 0x16c: 0x2c406, // target + 0x16d: 0x20605, // small + 0x16e: 0x6ca07, // onwheel + 0x16f: 0x1c90a, // annotation + 0x170: 0x4740a, // spellcheck + 0x171: 0x7207, // details + 0x172: 0x10306, // canvas + 0x173: 0x12109, // autofocus + 0x174: 0xc05, // param + 0x176: 0x46308, // download + 0x177: 0x45203, // del + 0x178: 0x36c07, // onclose + 0x179: 0xb903, // kbd + 0x17a: 0x31906, // applet + 0x17b: 0x2e004, // href + 0x17c: 0x5f108, // onresize + 0x17e: 0x49d0c, // onloadeddata + 0x180: 0xcc02, // tr + 0x181: 0x2c00a, // formtarget + 0x182: 0x11005, // title + 0x183: 0x6ff05, // style + 0x184: 0xd206, // strike + 0x185: 0x59e06, // usemap + 0x186: 0x2fc06, // iframe + 0x187: 0x1004, // main + 0x189: 0x7b07, // picture + 0x18c: 0x31605, // ismap + 0x18e: 0x4a504, // data + 0x18f: 0x5905, // label + 0x191: 0x3d10e, // referrerpolicy + 0x192: 0x15602, // th + 0x194: 0x53606, // prompt + 0x195: 0x56807, // section + 0x197: 0x6d107, // optimum + 0x198: 0x2db04, // high + 0x199: 0x15c02, // h1 + 0x19a: 0x65909, // onstalled + 0x19b: 0x16d03, // var + 0x19c: 0x4204, // time + 0x19e: 0x67402, // ms + 0x19f: 0x33106, // header + 0x1a0: 0x4da09, // onmessage + 0x1a1: 0x1a605, // nonce + 0x1a2: 0x26e0a, // formaction + 0x1a3: 0x22006, // center + 0x1a4: 0x3704, // nobr + 0x1a5: 0x59505, // table + 0x1a6: 0x4a907, // listing + 0x1a7: 0x18106, // legend + 0x1a9: 0x29b09, // challenge + 0x1aa: 0x24806, // figure + 0x1ab: 0xe605, // media + 0x1ae: 0xd904, // type + 0x1af: 0x3f04, // font + 0x1b0: 0x4da0e, // onmessageerror + 0x1b1: 0x37108, // seamless + 0x1b2: 0x8703, // dfn + 0x1b3: 0x5c705, // defer + 0x1b4: 0xc303, // low + 0x1b5: 0x19a03, // rtc + 0x1b6: 0x5230b, // onmouseover + 0x1b7: 0x2b20a, // novalidate + 0x1b8: 0x71c0a, // workertype + 0x1ba: 0x3cd07, // itemref + 0x1bd: 0x1, // a + 0x1be: 0x31803, // map + 0x1bf: 0x400c, // ontimeupdate + 0x1c0: 0x15e07, // bgsound + 0x1c1: 0x3206, // keygen + 0x1c2: 0x2705, // tbody + 0x1c5: 0x64406, // onshow + 0x1c7: 0x2501, // s + 0x1c8: 0x6607, // pattern + 0x1cc: 0x14d10, // oncanplaythrough + 0x1ce: 0x2d702, // dd + 0x1cf: 0x6f906, // srcset + 0x1d0: 0x17003, // big + 0x1d2: 0x65108, // sortable + 0x1d3: 0x48007, // onkeyup + 0x1d5: 0x5a406, // onplay + 0x1d7: 0x4b804, // meta + 0x1d8: 0x40306, // ondrop + 0x1da: 0x60008, // onscroll + 0x1db: 0x1fb0b, // crossorigin + 0x1dc: 0x5730a, // onpageshow + 0x1dd: 0x4, // abbr + 0x1de: 0x9202, // td + 0x1df: 0x58b0f, // contenteditable + 0x1e0: 0x27206, // action + 0x1e1: 0x1400b, // playsinline + 0x1e2: 0x43107, // onfocus + 0x1e3: 0x2e008, // hreflang + 0x1e5: 0x5160a, // onmouseout + 0x1e6: 0x5ea07, // onreset + 0x1e7: 0x13c08, // autoplay + 0x1e8: 0x63109, // onseeking + 0x1ea: 0x67506, // scoped + 0x1ec: 0x30a, // radiogroup + 0x1ee: 0x3800b, // contextmenu + 0x1ef: 0x52e09, // onmouseup + 0x1f1: 0x2ca06, // hgroup + 0x1f2: 0x2080f, // allowfullscreen + 0x1f3: 0x4be08, // tabindex + 0x1f6: 0x30f07, // isindex + 0x1f7: 0x1a0e, // accept-charset + 0x1f8: 0x2ae0e, // formnovalidate + 0x1fb: 0x1c90e, // annotation-xml + 0x1fc: 0x6e05, // embed + 0x1fd: 0x21806, // script + 0x1fe: 0xbb06, // dialog + 0x1ff: 0x1d707, // command +} + +const atomText = "abbradiogrouparamainavalueaccept-charsetbodyaccesskeygenobrb" + + "asefontimeupdateviacacheightmlabelooptgroupatternoembedetail" + + "sampictureversedfnoframesetdirnameterowspanomoduleacronymali" + + "gnmarkbdialogallowpaymentrequestrikeytypeallowusermediagroup" + + "ingaltfooterubyasyncanvasidefaultitleaudioncancelautofocusan" + + "dboxmplaceholderautoplaysinlinebdoncanplaythrough1bgsoundisa" + + "bledivarbigblinkindraggablegendblockquotebuttonabortcitempro" + + "penoncecolgrouplaintextrackcolorcolspannotation-xmlcommandco" + + "ntrolshapecoordslotranslatecrossoriginsmallowfullscreenoscri" + + "ptfacenterfieldsetfigcaptionafterprintegrityfigurequiredfore" + + "ignObjectforeignobjectformactionautocompleteerrorformenctype" + + "mustmatchallengeformmethodformnovalidatetimeformtargethgroup" + + "osterhiddenhigh2hreflanghttp-equivideonclickiframeimageimgly" + + "ph3isindexismappletitemtypemarqueematheadersortedmaxlength4m" + + "inlength5mtextareadonlymultiplemutedoncloseamlessourceoncont" + + "extmenuitemidoncopyoncuechangeoncutondblclickondragendondrag" + + "enterondragexitemreferrerpolicyondragleaveondragoverondragst" + + "articleondropzonemptiedondurationchangeonendedonerroronfocus" + + "paceronhashchangeoninputmodeloninvalidonkeydownloadonkeypres" + + "spellcheckedonkeyupreloadonlanguagechangeonloadeddatalisting" + + "onloadedmetadatabindexonloadendonloadstartonmessageerroronmo" + + "usedownonmouseenteronmouseleaveonmousemoveonmouseoutputonmou" + + "seoveronmouseupromptonmousewheelonofflineononlineonpagehides" + + "classectionbluronpageshowbronpastepublicontenteditableonpaus" + + "emaponplayingonpopstateonprogressrcdocodeferonratechangeonre" + + "jectionhandledonresetonresizesrclangonscrollonsecuritypolicy" + + "violationauxclickonseekedonseekingonselectedonshowidth6onsor" + + "tableonstalledonstorageonsubmitemscopedonsuspendontoggleonun" + + "handledrejectionbeforeprintonunloadonvolumechangeonwaitingon" + + "wheeloptimumanifestrongoptionbeforeunloaddressrcsetstylesumm" + + "arysupsvgsystemplateworkertypewrap" diff --git a/vendor/golang.org/x/net/html/const.go b/vendor/golang.org/x/net/html/const.go new file mode 100644 index 0000000..ff7acf2 --- /dev/null +++ b/vendor/golang.org/x/net/html/const.go @@ -0,0 +1,111 @@ +// Copyright 2011 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package html + +// Section 12.2.4.2 of the HTML5 specification says "The following elements +// have varying levels of special parsing rules". +// https://html.spec.whatwg.org/multipage/syntax.html#the-stack-of-open-elements +var isSpecialElementMap = map[string]bool{ + "address": true, + "applet": true, + "area": true, + "article": true, + "aside": true, + "base": true, + "basefont": true, + "bgsound": true, + "blockquote": true, + "body": true, + "br": true, + "button": true, + "caption": true, + "center": true, + "col": true, + "colgroup": true, + "dd": true, + "details": true, + "dir": true, + "div": true, + "dl": true, + "dt": true, + "embed": true, + "fieldset": true, + "figcaption": true, + "figure": true, + "footer": true, + "form": true, + "frame": true, + "frameset": true, + "h1": true, + "h2": true, + "h3": true, + "h4": true, + "h5": true, + "h6": true, + "head": true, + "header": true, + "hgroup": true, + "hr": true, + "html": true, + "iframe": true, + "img": true, + "input": true, + "keygen": true, // "keygen" has been removed from the spec, but are kept here for backwards compatibility. + "li": true, + "link": true, + "listing": true, + "main": true, + "marquee": true, + "menu": true, + "meta": true, + "nav": true, + "noembed": true, + "noframes": true, + "noscript": true, + "object": true, + "ol": true, + "p": true, + "param": true, + "plaintext": true, + "pre": true, + "script": true, + "section": true, + "select": true, + "source": true, + "style": true, + "summary": true, + "table": true, + "tbody": true, + "td": true, + "template": true, + "textarea": true, + "tfoot": true, + "th": true, + "thead": true, + "title": true, + "tr": true, + "track": true, + "ul": true, + "wbr": true, + "xmp": true, +} + +func isSpecialElement(element *Node) bool { + switch element.Namespace { + case "", "html": + return isSpecialElementMap[element.Data] + case "math": + switch element.Data { + case "mi", "mo", "mn", "ms", "mtext", "annotation-xml": + return true + } + case "svg": + switch element.Data { + case "foreignObject", "desc", "title": + return true + } + } + return false +} diff --git a/vendor/golang.org/x/net/html/doc.go b/vendor/golang.org/x/net/html/doc.go new file mode 100644 index 0000000..2466ae3 --- /dev/null +++ b/vendor/golang.org/x/net/html/doc.go @@ -0,0 +1,127 @@ +// Copyright 2010 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +/* +Package html implements an HTML5-compliant tokenizer and parser. + +Tokenization is done by creating a Tokenizer for an io.Reader r. It is the +caller's responsibility to ensure that r provides UTF-8 encoded HTML. + + z := html.NewTokenizer(r) + +Given a Tokenizer z, the HTML is tokenized by repeatedly calling z.Next(), +which parses the next token and returns its type, or an error: + + for { + tt := z.Next() + if tt == html.ErrorToken { + // ... + return ... + } + // Process the current token. + } + +There are two APIs for retrieving the current token. The high-level API is to +call Token; the low-level API is to call Text or TagName / TagAttr. Both APIs +allow optionally calling Raw after Next but before Token, Text, TagName, or +TagAttr. In EBNF notation, the valid call sequence per token is: + + Next {Raw} [ Token | Text | TagName {TagAttr} ] + +Token returns an independent data structure that completely describes a token. +Entities (such as "<") are unescaped, tag names and attribute keys are +lower-cased, and attributes are collected into a []Attribute. For example: + + for { + if z.Next() == html.ErrorToken { + // Returning io.EOF indicates success. + return z.Err() + } + emitToken(z.Token()) + } + +The low-level API performs fewer allocations and copies, but the contents of +the []byte values returned by Text, TagName and TagAttr may change on the next +call to Next. For example, to extract an HTML page's anchor text: + + depth := 0 + for { + tt := z.Next() + switch tt { + case html.ErrorToken: + return z.Err() + case html.TextToken: + if depth > 0 { + // emitBytes should copy the []byte it receives, + // if it doesn't process it immediately. + emitBytes(z.Text()) + } + case html.StartTagToken, html.EndTagToken: + tn, _ := z.TagName() + if len(tn) == 1 && tn[0] == 'a' { + if tt == html.StartTagToken { + depth++ + } else { + depth-- + } + } + } + } + +Parsing is done by calling Parse with an io.Reader, which returns the root of +the parse tree (the document element) as a *Node. It is the caller's +responsibility to ensure that the Reader provides UTF-8 encoded HTML. For +example, to process each anchor node in depth-first order: + + doc, err := html.Parse(r) + if err != nil { + // ... + } + var f func(*html.Node) + f = func(n *html.Node) { + if n.Type == html.ElementNode && n.Data == "a" { + // Do something with n... + } + for c := n.FirstChild; c != nil; c = c.NextSibling { + f(c) + } + } + f(doc) + +The relevant specifications include: +https://html.spec.whatwg.org/multipage/syntax.html and +https://html.spec.whatwg.org/multipage/syntax.html#tokenization + +# Security Considerations + +Care should be taken when parsing and interpreting HTML, whether full documents +or fragments, within the framework of the HTML specification, especially with +regard to untrusted inputs. + +This package provides both a tokenizer and a parser, which implement the +tokenization, and tokenization and tree construction stages of the WHATWG HTML +parsing specification respectively. While the tokenizer parses and normalizes +individual HTML tokens, only the parser constructs the DOM tree from the +tokenized HTML, as described in the tree construction stage of the +specification, dynamically modifying or extending the docuemnt's DOM tree. + +If your use case requires semantically well-formed HTML documents, as defined by +the WHATWG specification, the parser should be used rather than the tokenizer. + +In security contexts, if trust decisions are being made using the tokenized or +parsed content, the input must be re-serialized (for instance by using Render or +Token.String) in order for those trust decisions to hold, as the process of +tokenization or parsing may alter the content. +*/ +package html // import "golang.org/x/net/html" + +// The tokenization algorithm implemented by this package is not a line-by-line +// transliteration of the relatively verbose state-machine in the WHATWG +// specification. A more direct approach is used instead, where the program +// counter implies the state, such as whether it is tokenizing a tag or a text +// node. Specification compliance is verified by checking expected and actual +// outputs over a test suite rather than aiming for algorithmic fidelity. + +// TODO(nigeltao): Does a DOM API belong in this package or a separate one? +// TODO(nigeltao): How does parsing interact with a JavaScript engine? diff --git a/vendor/golang.org/x/net/html/doctype.go b/vendor/golang.org/x/net/html/doctype.go new file mode 100644 index 0000000..c484e5a --- /dev/null +++ b/vendor/golang.org/x/net/html/doctype.go @@ -0,0 +1,156 @@ +// Copyright 2011 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package html + +import ( + "strings" +) + +// parseDoctype parses the data from a DoctypeToken into a name, +// public identifier, and system identifier. It returns a Node whose Type +// is DoctypeNode, whose Data is the name, and which has attributes +// named "system" and "public" for the two identifiers if they were present. +// quirks is whether the document should be parsed in "quirks mode". +func parseDoctype(s string) (n *Node, quirks bool) { + n = &Node{Type: DoctypeNode} + + // Find the name. + space := strings.IndexAny(s, whitespace) + if space == -1 { + space = len(s) + } + n.Data = s[:space] + // The comparison to "html" is case-sensitive. + if n.Data != "html" { + quirks = true + } + n.Data = strings.ToLower(n.Data) + s = strings.TrimLeft(s[space:], whitespace) + + if len(s) < 6 { + // It can't start with "PUBLIC" or "SYSTEM". + // Ignore the rest of the string. + return n, quirks || s != "" + } + + key := strings.ToLower(s[:6]) + s = s[6:] + for key == "public" || key == "system" { + s = strings.TrimLeft(s, whitespace) + if s == "" { + break + } + quote := s[0] + if quote != '"' && quote != '\'' { + break + } + s = s[1:] + q := strings.IndexRune(s, rune(quote)) + var id string + if q == -1 { + id = s + s = "" + } else { + id = s[:q] + s = s[q+1:] + } + n.Attr = append(n.Attr, Attribute{Key: key, Val: id}) + if key == "public" { + key = "system" + } else { + key = "" + } + } + + if key != "" || s != "" { + quirks = true + } else if len(n.Attr) > 0 { + if n.Attr[0].Key == "public" { + public := strings.ToLower(n.Attr[0].Val) + switch public { + case "-//w3o//dtd w3 html strict 3.0//en//", "-/w3d/dtd html 4.0 transitional/en", "html": + quirks = true + default: + for _, q := range quirkyIDs { + if strings.HasPrefix(public, q) { + quirks = true + break + } + } + } + // The following two public IDs only cause quirks mode if there is no system ID. + if len(n.Attr) == 1 && (strings.HasPrefix(public, "-//w3c//dtd html 4.01 frameset//") || + strings.HasPrefix(public, "-//w3c//dtd html 4.01 transitional//")) { + quirks = true + } + } + if lastAttr := n.Attr[len(n.Attr)-1]; lastAttr.Key == "system" && + strings.ToLower(lastAttr.Val) == "http://www.ibm.com/data/dtd/v11/ibmxhtml1-transitional.dtd" { + quirks = true + } + } + + return n, quirks +} + +// quirkyIDs is a list of public doctype identifiers that cause a document +// to be interpreted in quirks mode. The identifiers should be in lower case. +var quirkyIDs = []string{ + "+//silmaril//dtd html pro v0r11 19970101//", + "-//advasoft ltd//dtd html 3.0 aswedit + extensions//", + "-//as//dtd html 3.0 aswedit + extensions//", + "-//ietf//dtd html 2.0 level 1//", + "-//ietf//dtd html 2.0 level 2//", + "-//ietf//dtd html 2.0 strict level 1//", + "-//ietf//dtd html 2.0 strict level 2//", + "-//ietf//dtd html 2.0 strict//", + "-//ietf//dtd html 2.0//", + "-//ietf//dtd html 2.1e//", + "-//ietf//dtd html 3.0//", + "-//ietf//dtd html 3.2 final//", + "-//ietf//dtd html 3.2//", + "-//ietf//dtd html 3//", + "-//ietf//dtd html level 0//", + "-//ietf//dtd html level 1//", + "-//ietf//dtd html level 2//", + "-//ietf//dtd html level 3//", + "-//ietf//dtd html strict level 0//", + "-//ietf//dtd html strict level 1//", + "-//ietf//dtd html strict level 2//", + "-//ietf//dtd html strict level 3//", + "-//ietf//dtd html strict//", + "-//ietf//dtd html//", + "-//metrius//dtd metrius presentational//", + "-//microsoft//dtd internet explorer 2.0 html strict//", + "-//microsoft//dtd internet explorer 2.0 html//", + "-//microsoft//dtd internet explorer 2.0 tables//", + "-//microsoft//dtd internet explorer 3.0 html strict//", + "-//microsoft//dtd internet explorer 3.0 html//", + "-//microsoft//dtd internet explorer 3.0 tables//", + "-//netscape comm. corp.//dtd html//", + "-//netscape comm. corp.//dtd strict html//", + "-//o'reilly and associates//dtd html 2.0//", + "-//o'reilly and associates//dtd html extended 1.0//", + "-//o'reilly and associates//dtd html extended relaxed 1.0//", + "-//softquad software//dtd hotmetal pro 6.0::19990601::extensions to html 4.0//", + "-//softquad//dtd hotmetal pro 4.0::19971010::extensions to html 4.0//", + "-//spyglass//dtd html 2.0 extended//", + "-//sq//dtd html 2.0 hotmetal + extensions//", + "-//sun microsystems corp.//dtd hotjava html//", + "-//sun microsystems corp.//dtd hotjava strict html//", + "-//w3c//dtd html 3 1995-03-24//", + "-//w3c//dtd html 3.2 draft//", + "-//w3c//dtd html 3.2 final//", + "-//w3c//dtd html 3.2//", + "-//w3c//dtd html 3.2s draft//", + "-//w3c//dtd html 4.0 frameset//", + "-//w3c//dtd html 4.0 transitional//", + "-//w3c//dtd html experimental 19960712//", + "-//w3c//dtd html experimental 970421//", + "-//w3c//dtd w3 html//", + "-//w3o//dtd w3 html 3.0//", + "-//webtechs//dtd mozilla html 2.0//", + "-//webtechs//dtd mozilla html//", +} diff --git a/vendor/golang.org/x/net/html/entity.go b/vendor/golang.org/x/net/html/entity.go new file mode 100644 index 0000000..b628880 --- /dev/null +++ b/vendor/golang.org/x/net/html/entity.go @@ -0,0 +1,2253 @@ +// Copyright 2010 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package html + +// All entities that do not end with ';' are 6 or fewer bytes long. +const longestEntityWithoutSemicolon = 6 + +// entity is a map from HTML entity names to their values. The semicolon matters: +// https://html.spec.whatwg.org/multipage/syntax.html#named-character-references +// lists both "amp" and "amp;" as two separate entries. +// +// Note that the HTML5 list is larger than the HTML4 list at +// http://www.w3.org/TR/html4/sgml/entities.html +var entity = map[string]rune{ + "AElig;": '\U000000C6', + "AMP;": '\U00000026', + "Aacute;": '\U000000C1', + "Abreve;": '\U00000102', + "Acirc;": '\U000000C2', + "Acy;": '\U00000410', + "Afr;": '\U0001D504', + "Agrave;": '\U000000C0', + "Alpha;": '\U00000391', + "Amacr;": '\U00000100', + "And;": '\U00002A53', + "Aogon;": '\U00000104', + "Aopf;": '\U0001D538', + "ApplyFunction;": '\U00002061', + "Aring;": '\U000000C5', + "Ascr;": '\U0001D49C', + "Assign;": '\U00002254', + "Atilde;": '\U000000C3', + "Auml;": '\U000000C4', + "Backslash;": '\U00002216', + "Barv;": '\U00002AE7', + "Barwed;": '\U00002306', + "Bcy;": '\U00000411', + "Because;": '\U00002235', + "Bernoullis;": '\U0000212C', + "Beta;": '\U00000392', + "Bfr;": '\U0001D505', + "Bopf;": '\U0001D539', + "Breve;": '\U000002D8', + "Bscr;": '\U0000212C', + "Bumpeq;": '\U0000224E', + "CHcy;": '\U00000427', + "COPY;": '\U000000A9', + "Cacute;": '\U00000106', + "Cap;": '\U000022D2', + "CapitalDifferentialD;": '\U00002145', + "Cayleys;": '\U0000212D', + "Ccaron;": '\U0000010C', + "Ccedil;": '\U000000C7', + "Ccirc;": '\U00000108', + "Cconint;": '\U00002230', + "Cdot;": '\U0000010A', + "Cedilla;": '\U000000B8', + "CenterDot;": '\U000000B7', + "Cfr;": '\U0000212D', + "Chi;": '\U000003A7', + "CircleDot;": '\U00002299', + "CircleMinus;": '\U00002296', + "CirclePlus;": '\U00002295', + "CircleTimes;": '\U00002297', + "ClockwiseContourIntegral;": '\U00002232', + "CloseCurlyDoubleQuote;": '\U0000201D', + "CloseCurlyQuote;": '\U00002019', + "Colon;": '\U00002237', + "Colone;": '\U00002A74', + "Congruent;": '\U00002261', + "Conint;": '\U0000222F', + "ContourIntegral;": '\U0000222E', + "Copf;": '\U00002102', + "Coproduct;": '\U00002210', + "CounterClockwiseContourIntegral;": '\U00002233', + "Cross;": '\U00002A2F', + "Cscr;": '\U0001D49E', + "Cup;": '\U000022D3', + "CupCap;": '\U0000224D', + "DD;": '\U00002145', + "DDotrahd;": '\U00002911', + "DJcy;": '\U00000402', + "DScy;": '\U00000405', + "DZcy;": '\U0000040F', + "Dagger;": '\U00002021', + "Darr;": '\U000021A1', + "Dashv;": '\U00002AE4', + "Dcaron;": '\U0000010E', + "Dcy;": '\U00000414', + "Del;": '\U00002207', + "Delta;": '\U00000394', + "Dfr;": '\U0001D507', + "DiacriticalAcute;": '\U000000B4', + "DiacriticalDot;": '\U000002D9', + "DiacriticalDoubleAcute;": '\U000002DD', + "DiacriticalGrave;": '\U00000060', + "DiacriticalTilde;": '\U000002DC', + "Diamond;": '\U000022C4', + "DifferentialD;": '\U00002146', + "Dopf;": '\U0001D53B', + "Dot;": '\U000000A8', + "DotDot;": '\U000020DC', + "DotEqual;": '\U00002250', + "DoubleContourIntegral;": '\U0000222F', + "DoubleDot;": '\U000000A8', + "DoubleDownArrow;": '\U000021D3', + "DoubleLeftArrow;": '\U000021D0', + "DoubleLeftRightArrow;": '\U000021D4', + "DoubleLeftTee;": '\U00002AE4', + "DoubleLongLeftArrow;": '\U000027F8', + "DoubleLongLeftRightArrow;": '\U000027FA', + "DoubleLongRightArrow;": '\U000027F9', + "DoubleRightArrow;": '\U000021D2', + "DoubleRightTee;": '\U000022A8', + "DoubleUpArrow;": '\U000021D1', + "DoubleUpDownArrow;": '\U000021D5', + "DoubleVerticalBar;": '\U00002225', + "DownArrow;": '\U00002193', + "DownArrowBar;": '\U00002913', + "DownArrowUpArrow;": '\U000021F5', + "DownBreve;": '\U00000311', + "DownLeftRightVector;": '\U00002950', + "DownLeftTeeVector;": '\U0000295E', + "DownLeftVector;": '\U000021BD', + "DownLeftVectorBar;": '\U00002956', + "DownRightTeeVector;": '\U0000295F', + "DownRightVector;": '\U000021C1', + "DownRightVectorBar;": '\U00002957', + "DownTee;": '\U000022A4', + "DownTeeArrow;": '\U000021A7', + "Downarrow;": '\U000021D3', + "Dscr;": '\U0001D49F', + "Dstrok;": '\U00000110', + "ENG;": '\U0000014A', + "ETH;": '\U000000D0', + "Eacute;": '\U000000C9', + "Ecaron;": '\U0000011A', + "Ecirc;": '\U000000CA', + "Ecy;": '\U0000042D', + "Edot;": '\U00000116', + "Efr;": '\U0001D508', + "Egrave;": '\U000000C8', + "Element;": '\U00002208', + "Emacr;": '\U00000112', + "EmptySmallSquare;": '\U000025FB', + "EmptyVerySmallSquare;": '\U000025AB', + "Eogon;": '\U00000118', + "Eopf;": '\U0001D53C', + "Epsilon;": '\U00000395', + "Equal;": '\U00002A75', + "EqualTilde;": '\U00002242', + "Equilibrium;": '\U000021CC', + "Escr;": '\U00002130', + "Esim;": '\U00002A73', + "Eta;": '\U00000397', + "Euml;": '\U000000CB', + "Exists;": '\U00002203', + "ExponentialE;": '\U00002147', + "Fcy;": '\U00000424', + "Ffr;": '\U0001D509', + "FilledSmallSquare;": '\U000025FC', + "FilledVerySmallSquare;": '\U000025AA', + "Fopf;": '\U0001D53D', + "ForAll;": '\U00002200', + "Fouriertrf;": '\U00002131', + "Fscr;": '\U00002131', + "GJcy;": '\U00000403', + "GT;": '\U0000003E', + "Gamma;": '\U00000393', + "Gammad;": '\U000003DC', + "Gbreve;": '\U0000011E', + "Gcedil;": '\U00000122', + "Gcirc;": '\U0000011C', + "Gcy;": '\U00000413', + "Gdot;": '\U00000120', + "Gfr;": '\U0001D50A', + "Gg;": '\U000022D9', + "Gopf;": '\U0001D53E', + "GreaterEqual;": '\U00002265', + "GreaterEqualLess;": '\U000022DB', + "GreaterFullEqual;": '\U00002267', + "GreaterGreater;": '\U00002AA2', + "GreaterLess;": '\U00002277', + "GreaterSlantEqual;": '\U00002A7E', + "GreaterTilde;": '\U00002273', + "Gscr;": '\U0001D4A2', + "Gt;": '\U0000226B', + "HARDcy;": '\U0000042A', + "Hacek;": '\U000002C7', + "Hat;": '\U0000005E', + "Hcirc;": '\U00000124', + "Hfr;": '\U0000210C', + "HilbertSpace;": '\U0000210B', + "Hopf;": '\U0000210D', + "HorizontalLine;": '\U00002500', + "Hscr;": '\U0000210B', + "Hstrok;": '\U00000126', + "HumpDownHump;": '\U0000224E', + "HumpEqual;": '\U0000224F', + "IEcy;": '\U00000415', + "IJlig;": '\U00000132', + "IOcy;": '\U00000401', + "Iacute;": '\U000000CD', + "Icirc;": '\U000000CE', + "Icy;": '\U00000418', + "Idot;": '\U00000130', + "Ifr;": '\U00002111', + "Igrave;": '\U000000CC', + "Im;": '\U00002111', + "Imacr;": '\U0000012A', + "ImaginaryI;": '\U00002148', + "Implies;": '\U000021D2', + "Int;": '\U0000222C', + "Integral;": '\U0000222B', + "Intersection;": '\U000022C2', + "InvisibleComma;": '\U00002063', + "InvisibleTimes;": '\U00002062', + "Iogon;": '\U0000012E', + "Iopf;": '\U0001D540', + "Iota;": '\U00000399', + "Iscr;": '\U00002110', + "Itilde;": '\U00000128', + "Iukcy;": '\U00000406', + "Iuml;": '\U000000CF', + "Jcirc;": '\U00000134', + "Jcy;": '\U00000419', + "Jfr;": '\U0001D50D', + "Jopf;": '\U0001D541', + "Jscr;": '\U0001D4A5', + "Jsercy;": '\U00000408', + "Jukcy;": '\U00000404', + "KHcy;": '\U00000425', + "KJcy;": '\U0000040C', + "Kappa;": '\U0000039A', + "Kcedil;": '\U00000136', + "Kcy;": '\U0000041A', + "Kfr;": '\U0001D50E', + "Kopf;": '\U0001D542', + "Kscr;": '\U0001D4A6', + "LJcy;": '\U00000409', + "LT;": '\U0000003C', + "Lacute;": '\U00000139', + "Lambda;": '\U0000039B', + "Lang;": '\U000027EA', + "Laplacetrf;": '\U00002112', + "Larr;": '\U0000219E', + "Lcaron;": '\U0000013D', + "Lcedil;": '\U0000013B', + "Lcy;": '\U0000041B', + "LeftAngleBracket;": '\U000027E8', + "LeftArrow;": '\U00002190', + "LeftArrowBar;": '\U000021E4', + "LeftArrowRightArrow;": '\U000021C6', + "LeftCeiling;": '\U00002308', + "LeftDoubleBracket;": '\U000027E6', + "LeftDownTeeVector;": '\U00002961', + "LeftDownVector;": '\U000021C3', + "LeftDownVectorBar;": '\U00002959', + "LeftFloor;": '\U0000230A', + "LeftRightArrow;": '\U00002194', + "LeftRightVector;": '\U0000294E', + "LeftTee;": '\U000022A3', + "LeftTeeArrow;": '\U000021A4', + "LeftTeeVector;": '\U0000295A', + "LeftTriangle;": '\U000022B2', + "LeftTriangleBar;": '\U000029CF', + "LeftTriangleEqual;": '\U000022B4', + "LeftUpDownVector;": '\U00002951', + "LeftUpTeeVector;": '\U00002960', + "LeftUpVector;": '\U000021BF', + "LeftUpVectorBar;": '\U00002958', + "LeftVector;": '\U000021BC', + "LeftVectorBar;": '\U00002952', + "Leftarrow;": '\U000021D0', + "Leftrightarrow;": '\U000021D4', + "LessEqualGreater;": '\U000022DA', + "LessFullEqual;": '\U00002266', + "LessGreater;": '\U00002276', + "LessLess;": '\U00002AA1', + "LessSlantEqual;": '\U00002A7D', + "LessTilde;": '\U00002272', + "Lfr;": '\U0001D50F', + "Ll;": '\U000022D8', + "Lleftarrow;": '\U000021DA', + "Lmidot;": '\U0000013F', + "LongLeftArrow;": '\U000027F5', + "LongLeftRightArrow;": '\U000027F7', + "LongRightArrow;": '\U000027F6', + "Longleftarrow;": '\U000027F8', + "Longleftrightarrow;": '\U000027FA', + "Longrightarrow;": '\U000027F9', + "Lopf;": '\U0001D543', + "LowerLeftArrow;": '\U00002199', + "LowerRightArrow;": '\U00002198', + "Lscr;": '\U00002112', + "Lsh;": '\U000021B0', + "Lstrok;": '\U00000141', + "Lt;": '\U0000226A', + "Map;": '\U00002905', + "Mcy;": '\U0000041C', + "MediumSpace;": '\U0000205F', + "Mellintrf;": '\U00002133', + "Mfr;": '\U0001D510', + "MinusPlus;": '\U00002213', + "Mopf;": '\U0001D544', + "Mscr;": '\U00002133', + "Mu;": '\U0000039C', + "NJcy;": '\U0000040A', + "Nacute;": '\U00000143', + "Ncaron;": '\U00000147', + "Ncedil;": '\U00000145', + "Ncy;": '\U0000041D', + "NegativeMediumSpace;": '\U0000200B', + "NegativeThickSpace;": '\U0000200B', + "NegativeThinSpace;": '\U0000200B', + "NegativeVeryThinSpace;": '\U0000200B', + "NestedGreaterGreater;": '\U0000226B', + "NestedLessLess;": '\U0000226A', + "NewLine;": '\U0000000A', + "Nfr;": '\U0001D511', + "NoBreak;": '\U00002060', + "NonBreakingSpace;": '\U000000A0', + "Nopf;": '\U00002115', + "Not;": '\U00002AEC', + "NotCongruent;": '\U00002262', + "NotCupCap;": '\U0000226D', + "NotDoubleVerticalBar;": '\U00002226', + "NotElement;": '\U00002209', + "NotEqual;": '\U00002260', + "NotExists;": '\U00002204', + "NotGreater;": '\U0000226F', + "NotGreaterEqual;": '\U00002271', + "NotGreaterLess;": '\U00002279', + "NotGreaterTilde;": '\U00002275', + "NotLeftTriangle;": '\U000022EA', + "NotLeftTriangleEqual;": '\U000022EC', + "NotLess;": '\U0000226E', + "NotLessEqual;": '\U00002270', + "NotLessGreater;": '\U00002278', + "NotLessTilde;": '\U00002274', + "NotPrecedes;": '\U00002280', + "NotPrecedesSlantEqual;": '\U000022E0', + "NotReverseElement;": '\U0000220C', + "NotRightTriangle;": '\U000022EB', + "NotRightTriangleEqual;": '\U000022ED', + "NotSquareSubsetEqual;": '\U000022E2', + "NotSquareSupersetEqual;": '\U000022E3', + "NotSubsetEqual;": '\U00002288', + "NotSucceeds;": '\U00002281', + "NotSucceedsSlantEqual;": '\U000022E1', + "NotSupersetEqual;": '\U00002289', + "NotTilde;": '\U00002241', + "NotTildeEqual;": '\U00002244', + "NotTildeFullEqual;": '\U00002247', + "NotTildeTilde;": '\U00002249', + "NotVerticalBar;": '\U00002224', + "Nscr;": '\U0001D4A9', + "Ntilde;": '\U000000D1', + "Nu;": '\U0000039D', + "OElig;": '\U00000152', + "Oacute;": '\U000000D3', + "Ocirc;": '\U000000D4', + "Ocy;": '\U0000041E', + "Odblac;": '\U00000150', + "Ofr;": '\U0001D512', + "Ograve;": '\U000000D2', + "Omacr;": '\U0000014C', + "Omega;": '\U000003A9', + "Omicron;": '\U0000039F', + "Oopf;": '\U0001D546', + "OpenCurlyDoubleQuote;": '\U0000201C', + "OpenCurlyQuote;": '\U00002018', + "Or;": '\U00002A54', + "Oscr;": '\U0001D4AA', + "Oslash;": '\U000000D8', + "Otilde;": '\U000000D5', + "Otimes;": '\U00002A37', + "Ouml;": '\U000000D6', + "OverBar;": '\U0000203E', + "OverBrace;": '\U000023DE', + "OverBracket;": '\U000023B4', + "OverParenthesis;": '\U000023DC', + "PartialD;": '\U00002202', + "Pcy;": '\U0000041F', + "Pfr;": '\U0001D513', + "Phi;": '\U000003A6', + "Pi;": '\U000003A0', + "PlusMinus;": '\U000000B1', + "Poincareplane;": '\U0000210C', + "Popf;": '\U00002119', + "Pr;": '\U00002ABB', + "Precedes;": '\U0000227A', + "PrecedesEqual;": '\U00002AAF', + "PrecedesSlantEqual;": '\U0000227C', + "PrecedesTilde;": '\U0000227E', + "Prime;": '\U00002033', + "Product;": '\U0000220F', + "Proportion;": '\U00002237', + "Proportional;": '\U0000221D', + "Pscr;": '\U0001D4AB', + "Psi;": '\U000003A8', + "QUOT;": '\U00000022', + "Qfr;": '\U0001D514', + "Qopf;": '\U0000211A', + "Qscr;": '\U0001D4AC', + "RBarr;": '\U00002910', + "REG;": '\U000000AE', + "Racute;": '\U00000154', + "Rang;": '\U000027EB', + "Rarr;": '\U000021A0', + "Rarrtl;": '\U00002916', + "Rcaron;": '\U00000158', + "Rcedil;": '\U00000156', + "Rcy;": '\U00000420', + "Re;": '\U0000211C', + "ReverseElement;": '\U0000220B', + "ReverseEquilibrium;": '\U000021CB', + "ReverseUpEquilibrium;": '\U0000296F', + "Rfr;": '\U0000211C', + "Rho;": '\U000003A1', + "RightAngleBracket;": '\U000027E9', + "RightArrow;": '\U00002192', + "RightArrowBar;": '\U000021E5', + "RightArrowLeftArrow;": '\U000021C4', + "RightCeiling;": '\U00002309', + "RightDoubleBracket;": '\U000027E7', + "RightDownTeeVector;": '\U0000295D', + "RightDownVector;": '\U000021C2', + "RightDownVectorBar;": '\U00002955', + "RightFloor;": '\U0000230B', + "RightTee;": '\U000022A2', + "RightTeeArrow;": '\U000021A6', + "RightTeeVector;": '\U0000295B', + "RightTriangle;": '\U000022B3', + "RightTriangleBar;": '\U000029D0', + "RightTriangleEqual;": '\U000022B5', + "RightUpDownVector;": '\U0000294F', + "RightUpTeeVector;": '\U0000295C', + "RightUpVector;": '\U000021BE', + "RightUpVectorBar;": '\U00002954', + "RightVector;": '\U000021C0', + "RightVectorBar;": '\U00002953', + "Rightarrow;": '\U000021D2', + "Ropf;": '\U0000211D', + "RoundImplies;": '\U00002970', + "Rrightarrow;": '\U000021DB', + "Rscr;": '\U0000211B', + "Rsh;": '\U000021B1', + "RuleDelayed;": '\U000029F4', + "SHCHcy;": '\U00000429', + "SHcy;": '\U00000428', + "SOFTcy;": '\U0000042C', + "Sacute;": '\U0000015A', + "Sc;": '\U00002ABC', + "Scaron;": '\U00000160', + "Scedil;": '\U0000015E', + "Scirc;": '\U0000015C', + "Scy;": '\U00000421', + "Sfr;": '\U0001D516', + "ShortDownArrow;": '\U00002193', + "ShortLeftArrow;": '\U00002190', + "ShortRightArrow;": '\U00002192', + "ShortUpArrow;": '\U00002191', + "Sigma;": '\U000003A3', + "SmallCircle;": '\U00002218', + "Sopf;": '\U0001D54A', + "Sqrt;": '\U0000221A', + "Square;": '\U000025A1', + "SquareIntersection;": '\U00002293', + "SquareSubset;": '\U0000228F', + "SquareSubsetEqual;": '\U00002291', + "SquareSuperset;": '\U00002290', + "SquareSupersetEqual;": '\U00002292', + "SquareUnion;": '\U00002294', + "Sscr;": '\U0001D4AE', + "Star;": '\U000022C6', + "Sub;": '\U000022D0', + "Subset;": '\U000022D0', + "SubsetEqual;": '\U00002286', + "Succeeds;": '\U0000227B', + "SucceedsEqual;": '\U00002AB0', + "SucceedsSlantEqual;": '\U0000227D', + "SucceedsTilde;": '\U0000227F', + "SuchThat;": '\U0000220B', + "Sum;": '\U00002211', + "Sup;": '\U000022D1', + "Superset;": '\U00002283', + "SupersetEqual;": '\U00002287', + "Supset;": '\U000022D1', + "THORN;": '\U000000DE', + "TRADE;": '\U00002122', + "TSHcy;": '\U0000040B', + "TScy;": '\U00000426', + "Tab;": '\U00000009', + "Tau;": '\U000003A4', + "Tcaron;": '\U00000164', + "Tcedil;": '\U00000162', + "Tcy;": '\U00000422', + "Tfr;": '\U0001D517', + "Therefore;": '\U00002234', + "Theta;": '\U00000398', + "ThinSpace;": '\U00002009', + "Tilde;": '\U0000223C', + "TildeEqual;": '\U00002243', + "TildeFullEqual;": '\U00002245', + "TildeTilde;": '\U00002248', + "Topf;": '\U0001D54B', + "TripleDot;": '\U000020DB', + "Tscr;": '\U0001D4AF', + "Tstrok;": '\U00000166', + "Uacute;": '\U000000DA', + "Uarr;": '\U0000219F', + "Uarrocir;": '\U00002949', + "Ubrcy;": '\U0000040E', + "Ubreve;": '\U0000016C', + "Ucirc;": '\U000000DB', + "Ucy;": '\U00000423', + "Udblac;": '\U00000170', + "Ufr;": '\U0001D518', + "Ugrave;": '\U000000D9', + "Umacr;": '\U0000016A', + "UnderBar;": '\U0000005F', + "UnderBrace;": '\U000023DF', + "UnderBracket;": '\U000023B5', + "UnderParenthesis;": '\U000023DD', + "Union;": '\U000022C3', + "UnionPlus;": '\U0000228E', + "Uogon;": '\U00000172', + "Uopf;": '\U0001D54C', + "UpArrow;": '\U00002191', + "UpArrowBar;": '\U00002912', + "UpArrowDownArrow;": '\U000021C5', + "UpDownArrow;": '\U00002195', + "UpEquilibrium;": '\U0000296E', + "UpTee;": '\U000022A5', + "UpTeeArrow;": '\U000021A5', + "Uparrow;": '\U000021D1', + "Updownarrow;": '\U000021D5', + "UpperLeftArrow;": '\U00002196', + "UpperRightArrow;": '\U00002197', + "Upsi;": '\U000003D2', + "Upsilon;": '\U000003A5', + "Uring;": '\U0000016E', + "Uscr;": '\U0001D4B0', + "Utilde;": '\U00000168', + "Uuml;": '\U000000DC', + "VDash;": '\U000022AB', + "Vbar;": '\U00002AEB', + "Vcy;": '\U00000412', + "Vdash;": '\U000022A9', + "Vdashl;": '\U00002AE6', + "Vee;": '\U000022C1', + "Verbar;": '\U00002016', + "Vert;": '\U00002016', + "VerticalBar;": '\U00002223', + "VerticalLine;": '\U0000007C', + "VerticalSeparator;": '\U00002758', + "VerticalTilde;": '\U00002240', + "VeryThinSpace;": '\U0000200A', + "Vfr;": '\U0001D519', + "Vopf;": '\U0001D54D', + "Vscr;": '\U0001D4B1', + "Vvdash;": '\U000022AA', + "Wcirc;": '\U00000174', + "Wedge;": '\U000022C0', + "Wfr;": '\U0001D51A', + "Wopf;": '\U0001D54E', + "Wscr;": '\U0001D4B2', + "Xfr;": '\U0001D51B', + "Xi;": '\U0000039E', + "Xopf;": '\U0001D54F', + "Xscr;": '\U0001D4B3', + "YAcy;": '\U0000042F', + "YIcy;": '\U00000407', + "YUcy;": '\U0000042E', + "Yacute;": '\U000000DD', + "Ycirc;": '\U00000176', + "Ycy;": '\U0000042B', + "Yfr;": '\U0001D51C', + "Yopf;": '\U0001D550', + "Yscr;": '\U0001D4B4', + "Yuml;": '\U00000178', + "ZHcy;": '\U00000416', + "Zacute;": '\U00000179', + "Zcaron;": '\U0000017D', + "Zcy;": '\U00000417', + "Zdot;": '\U0000017B', + "ZeroWidthSpace;": '\U0000200B', + "Zeta;": '\U00000396', + "Zfr;": '\U00002128', + "Zopf;": '\U00002124', + "Zscr;": '\U0001D4B5', + "aacute;": '\U000000E1', + "abreve;": '\U00000103', + "ac;": '\U0000223E', + "acd;": '\U0000223F', + "acirc;": '\U000000E2', + "acute;": '\U000000B4', + "acy;": '\U00000430', + "aelig;": '\U000000E6', + "af;": '\U00002061', + "afr;": '\U0001D51E', + "agrave;": '\U000000E0', + "alefsym;": '\U00002135', + "aleph;": '\U00002135', + "alpha;": '\U000003B1', + "amacr;": '\U00000101', + "amalg;": '\U00002A3F', + "amp;": '\U00000026', + "and;": '\U00002227', + "andand;": '\U00002A55', + "andd;": '\U00002A5C', + "andslope;": '\U00002A58', + "andv;": '\U00002A5A', + "ang;": '\U00002220', + "ange;": '\U000029A4', + "angle;": '\U00002220', + "angmsd;": '\U00002221', + "angmsdaa;": '\U000029A8', + "angmsdab;": '\U000029A9', + "angmsdac;": '\U000029AA', + "angmsdad;": '\U000029AB', + "angmsdae;": '\U000029AC', + "angmsdaf;": '\U000029AD', + "angmsdag;": '\U000029AE', + "angmsdah;": '\U000029AF', + "angrt;": '\U0000221F', + "angrtvb;": '\U000022BE', + "angrtvbd;": '\U0000299D', + "angsph;": '\U00002222', + "angst;": '\U000000C5', + "angzarr;": '\U0000237C', + "aogon;": '\U00000105', + "aopf;": '\U0001D552', + "ap;": '\U00002248', + "apE;": '\U00002A70', + "apacir;": '\U00002A6F', + "ape;": '\U0000224A', + "apid;": '\U0000224B', + "apos;": '\U00000027', + "approx;": '\U00002248', + "approxeq;": '\U0000224A', + "aring;": '\U000000E5', + "ascr;": '\U0001D4B6', + "ast;": '\U0000002A', + "asymp;": '\U00002248', + "asympeq;": '\U0000224D', + "atilde;": '\U000000E3', + "auml;": '\U000000E4', + "awconint;": '\U00002233', + "awint;": '\U00002A11', + "bNot;": '\U00002AED', + "backcong;": '\U0000224C', + "backepsilon;": '\U000003F6', + "backprime;": '\U00002035', + "backsim;": '\U0000223D', + "backsimeq;": '\U000022CD', + "barvee;": '\U000022BD', + "barwed;": '\U00002305', + "barwedge;": '\U00002305', + "bbrk;": '\U000023B5', + "bbrktbrk;": '\U000023B6', + "bcong;": '\U0000224C', + "bcy;": '\U00000431', + "bdquo;": '\U0000201E', + "becaus;": '\U00002235', + "because;": '\U00002235', + "bemptyv;": '\U000029B0', + "bepsi;": '\U000003F6', + "bernou;": '\U0000212C', + "beta;": '\U000003B2', + "beth;": '\U00002136', + "between;": '\U0000226C', + "bfr;": '\U0001D51F', + "bigcap;": '\U000022C2', + "bigcirc;": '\U000025EF', + "bigcup;": '\U000022C3', + "bigodot;": '\U00002A00', + "bigoplus;": '\U00002A01', + "bigotimes;": '\U00002A02', + "bigsqcup;": '\U00002A06', + "bigstar;": '\U00002605', + "bigtriangledown;": '\U000025BD', + "bigtriangleup;": '\U000025B3', + "biguplus;": '\U00002A04', + "bigvee;": '\U000022C1', + "bigwedge;": '\U000022C0', + "bkarow;": '\U0000290D', + "blacklozenge;": '\U000029EB', + "blacksquare;": '\U000025AA', + "blacktriangle;": '\U000025B4', + "blacktriangledown;": '\U000025BE', + "blacktriangleleft;": '\U000025C2', + "blacktriangleright;": '\U000025B8', + "blank;": '\U00002423', + "blk12;": '\U00002592', + "blk14;": '\U00002591', + "blk34;": '\U00002593', + "block;": '\U00002588', + "bnot;": '\U00002310', + "bopf;": '\U0001D553', + "bot;": '\U000022A5', + "bottom;": '\U000022A5', + "bowtie;": '\U000022C8', + "boxDL;": '\U00002557', + "boxDR;": '\U00002554', + "boxDl;": '\U00002556', + "boxDr;": '\U00002553', + "boxH;": '\U00002550', + "boxHD;": '\U00002566', + "boxHU;": '\U00002569', + "boxHd;": '\U00002564', + "boxHu;": '\U00002567', + "boxUL;": '\U0000255D', + "boxUR;": '\U0000255A', + "boxUl;": '\U0000255C', + "boxUr;": '\U00002559', + "boxV;": '\U00002551', + "boxVH;": '\U0000256C', + "boxVL;": '\U00002563', + "boxVR;": '\U00002560', + "boxVh;": '\U0000256B', + "boxVl;": '\U00002562', + "boxVr;": '\U0000255F', + "boxbox;": '\U000029C9', + "boxdL;": '\U00002555', + "boxdR;": '\U00002552', + "boxdl;": '\U00002510', + "boxdr;": '\U0000250C', + "boxh;": '\U00002500', + "boxhD;": '\U00002565', + "boxhU;": '\U00002568', + "boxhd;": '\U0000252C', + "boxhu;": '\U00002534', + "boxminus;": '\U0000229F', + "boxplus;": '\U0000229E', + "boxtimes;": '\U000022A0', + "boxuL;": '\U0000255B', + "boxuR;": '\U00002558', + "boxul;": '\U00002518', + "boxur;": '\U00002514', + "boxv;": '\U00002502', + "boxvH;": '\U0000256A', + "boxvL;": '\U00002561', + "boxvR;": '\U0000255E', + "boxvh;": '\U0000253C', + "boxvl;": '\U00002524', + "boxvr;": '\U0000251C', + "bprime;": '\U00002035', + "breve;": '\U000002D8', + "brvbar;": '\U000000A6', + "bscr;": '\U0001D4B7', + "bsemi;": '\U0000204F', + "bsim;": '\U0000223D', + "bsime;": '\U000022CD', + "bsol;": '\U0000005C', + "bsolb;": '\U000029C5', + "bsolhsub;": '\U000027C8', + "bull;": '\U00002022', + "bullet;": '\U00002022', + "bump;": '\U0000224E', + "bumpE;": '\U00002AAE', + "bumpe;": '\U0000224F', + "bumpeq;": '\U0000224F', + "cacute;": '\U00000107', + "cap;": '\U00002229', + "capand;": '\U00002A44', + "capbrcup;": '\U00002A49', + "capcap;": '\U00002A4B', + "capcup;": '\U00002A47', + "capdot;": '\U00002A40', + "caret;": '\U00002041', + "caron;": '\U000002C7', + "ccaps;": '\U00002A4D', + "ccaron;": '\U0000010D', + "ccedil;": '\U000000E7', + "ccirc;": '\U00000109', + "ccups;": '\U00002A4C', + "ccupssm;": '\U00002A50', + "cdot;": '\U0000010B', + "cedil;": '\U000000B8', + "cemptyv;": '\U000029B2', + "cent;": '\U000000A2', + "centerdot;": '\U000000B7', + "cfr;": '\U0001D520', + "chcy;": '\U00000447', + "check;": '\U00002713', + "checkmark;": '\U00002713', + "chi;": '\U000003C7', + "cir;": '\U000025CB', + "cirE;": '\U000029C3', + "circ;": '\U000002C6', + "circeq;": '\U00002257', + "circlearrowleft;": '\U000021BA', + "circlearrowright;": '\U000021BB', + "circledR;": '\U000000AE', + "circledS;": '\U000024C8', + "circledast;": '\U0000229B', + "circledcirc;": '\U0000229A', + "circleddash;": '\U0000229D', + "cire;": '\U00002257', + "cirfnint;": '\U00002A10', + "cirmid;": '\U00002AEF', + "cirscir;": '\U000029C2', + "clubs;": '\U00002663', + "clubsuit;": '\U00002663', + "colon;": '\U0000003A', + "colone;": '\U00002254', + "coloneq;": '\U00002254', + "comma;": '\U0000002C', + "commat;": '\U00000040', + "comp;": '\U00002201', + "compfn;": '\U00002218', + "complement;": '\U00002201', + "complexes;": '\U00002102', + "cong;": '\U00002245', + "congdot;": '\U00002A6D', + "conint;": '\U0000222E', + "copf;": '\U0001D554', + "coprod;": '\U00002210', + "copy;": '\U000000A9', + "copysr;": '\U00002117', + "crarr;": '\U000021B5', + "cross;": '\U00002717', + "cscr;": '\U0001D4B8', + "csub;": '\U00002ACF', + "csube;": '\U00002AD1', + "csup;": '\U00002AD0', + "csupe;": '\U00002AD2', + "ctdot;": '\U000022EF', + "cudarrl;": '\U00002938', + "cudarrr;": '\U00002935', + "cuepr;": '\U000022DE', + "cuesc;": '\U000022DF', + "cularr;": '\U000021B6', + "cularrp;": '\U0000293D', + "cup;": '\U0000222A', + "cupbrcap;": '\U00002A48', + "cupcap;": '\U00002A46', + "cupcup;": '\U00002A4A', + "cupdot;": '\U0000228D', + "cupor;": '\U00002A45', + "curarr;": '\U000021B7', + "curarrm;": '\U0000293C', + "curlyeqprec;": '\U000022DE', + "curlyeqsucc;": '\U000022DF', + "curlyvee;": '\U000022CE', + "curlywedge;": '\U000022CF', + "curren;": '\U000000A4', + "curvearrowleft;": '\U000021B6', + "curvearrowright;": '\U000021B7', + "cuvee;": '\U000022CE', + "cuwed;": '\U000022CF', + "cwconint;": '\U00002232', + "cwint;": '\U00002231', + "cylcty;": '\U0000232D', + "dArr;": '\U000021D3', + "dHar;": '\U00002965', + "dagger;": '\U00002020', + "daleth;": '\U00002138', + "darr;": '\U00002193', + "dash;": '\U00002010', + "dashv;": '\U000022A3', + "dbkarow;": '\U0000290F', + "dblac;": '\U000002DD', + "dcaron;": '\U0000010F', + "dcy;": '\U00000434', + "dd;": '\U00002146', + "ddagger;": '\U00002021', + "ddarr;": '\U000021CA', + "ddotseq;": '\U00002A77', + "deg;": '\U000000B0', + "delta;": '\U000003B4', + "demptyv;": '\U000029B1', + "dfisht;": '\U0000297F', + "dfr;": '\U0001D521', + "dharl;": '\U000021C3', + "dharr;": '\U000021C2', + "diam;": '\U000022C4', + "diamond;": '\U000022C4', + "diamondsuit;": '\U00002666', + "diams;": '\U00002666', + "die;": '\U000000A8', + "digamma;": '\U000003DD', + "disin;": '\U000022F2', + "div;": '\U000000F7', + "divide;": '\U000000F7', + "divideontimes;": '\U000022C7', + "divonx;": '\U000022C7', + "djcy;": '\U00000452', + "dlcorn;": '\U0000231E', + "dlcrop;": '\U0000230D', + "dollar;": '\U00000024', + "dopf;": '\U0001D555', + "dot;": '\U000002D9', + "doteq;": '\U00002250', + "doteqdot;": '\U00002251', + "dotminus;": '\U00002238', + "dotplus;": '\U00002214', + "dotsquare;": '\U000022A1', + "doublebarwedge;": '\U00002306', + "downarrow;": '\U00002193', + "downdownarrows;": '\U000021CA', + "downharpoonleft;": '\U000021C3', + "downharpoonright;": '\U000021C2', + "drbkarow;": '\U00002910', + "drcorn;": '\U0000231F', + "drcrop;": '\U0000230C', + "dscr;": '\U0001D4B9', + "dscy;": '\U00000455', + "dsol;": '\U000029F6', + "dstrok;": '\U00000111', + "dtdot;": '\U000022F1', + "dtri;": '\U000025BF', + "dtrif;": '\U000025BE', + "duarr;": '\U000021F5', + "duhar;": '\U0000296F', + "dwangle;": '\U000029A6', + "dzcy;": '\U0000045F', + "dzigrarr;": '\U000027FF', + "eDDot;": '\U00002A77', + "eDot;": '\U00002251', + "eacute;": '\U000000E9', + "easter;": '\U00002A6E', + "ecaron;": '\U0000011B', + "ecir;": '\U00002256', + "ecirc;": '\U000000EA', + "ecolon;": '\U00002255', + "ecy;": '\U0000044D', + "edot;": '\U00000117', + "ee;": '\U00002147', + "efDot;": '\U00002252', + "efr;": '\U0001D522', + "eg;": '\U00002A9A', + "egrave;": '\U000000E8', + "egs;": '\U00002A96', + "egsdot;": '\U00002A98', + "el;": '\U00002A99', + "elinters;": '\U000023E7', + "ell;": '\U00002113', + "els;": '\U00002A95', + "elsdot;": '\U00002A97', + "emacr;": '\U00000113', + "empty;": '\U00002205', + "emptyset;": '\U00002205', + "emptyv;": '\U00002205', + "emsp;": '\U00002003', + "emsp13;": '\U00002004', + "emsp14;": '\U00002005', + "eng;": '\U0000014B', + "ensp;": '\U00002002', + "eogon;": '\U00000119', + "eopf;": '\U0001D556', + "epar;": '\U000022D5', + "eparsl;": '\U000029E3', + "eplus;": '\U00002A71', + "epsi;": '\U000003B5', + "epsilon;": '\U000003B5', + "epsiv;": '\U000003F5', + "eqcirc;": '\U00002256', + "eqcolon;": '\U00002255', + "eqsim;": '\U00002242', + "eqslantgtr;": '\U00002A96', + "eqslantless;": '\U00002A95', + "equals;": '\U0000003D', + "equest;": '\U0000225F', + "equiv;": '\U00002261', + "equivDD;": '\U00002A78', + "eqvparsl;": '\U000029E5', + "erDot;": '\U00002253', + "erarr;": '\U00002971', + "escr;": '\U0000212F', + "esdot;": '\U00002250', + "esim;": '\U00002242', + "eta;": '\U000003B7', + "eth;": '\U000000F0', + "euml;": '\U000000EB', + "euro;": '\U000020AC', + "excl;": '\U00000021', + "exist;": '\U00002203', + "expectation;": '\U00002130', + "exponentiale;": '\U00002147', + "fallingdotseq;": '\U00002252', + "fcy;": '\U00000444', + "female;": '\U00002640', + "ffilig;": '\U0000FB03', + "fflig;": '\U0000FB00', + "ffllig;": '\U0000FB04', + "ffr;": '\U0001D523', + "filig;": '\U0000FB01', + "flat;": '\U0000266D', + "fllig;": '\U0000FB02', + "fltns;": '\U000025B1', + "fnof;": '\U00000192', + "fopf;": '\U0001D557', + "forall;": '\U00002200', + "fork;": '\U000022D4', + "forkv;": '\U00002AD9', + "fpartint;": '\U00002A0D', + "frac12;": '\U000000BD', + "frac13;": '\U00002153', + "frac14;": '\U000000BC', + "frac15;": '\U00002155', + "frac16;": '\U00002159', + "frac18;": '\U0000215B', + "frac23;": '\U00002154', + "frac25;": '\U00002156', + "frac34;": '\U000000BE', + "frac35;": '\U00002157', + "frac38;": '\U0000215C', + "frac45;": '\U00002158', + "frac56;": '\U0000215A', + "frac58;": '\U0000215D', + "frac78;": '\U0000215E', + "frasl;": '\U00002044', + "frown;": '\U00002322', + "fscr;": '\U0001D4BB', + "gE;": '\U00002267', + "gEl;": '\U00002A8C', + "gacute;": '\U000001F5', + "gamma;": '\U000003B3', + "gammad;": '\U000003DD', + "gap;": '\U00002A86', + "gbreve;": '\U0000011F', + "gcirc;": '\U0000011D', + "gcy;": '\U00000433', + "gdot;": '\U00000121', + "ge;": '\U00002265', + "gel;": '\U000022DB', + "geq;": '\U00002265', + "geqq;": '\U00002267', + "geqslant;": '\U00002A7E', + "ges;": '\U00002A7E', + "gescc;": '\U00002AA9', + "gesdot;": '\U00002A80', + "gesdoto;": '\U00002A82', + "gesdotol;": '\U00002A84', + "gesles;": '\U00002A94', + "gfr;": '\U0001D524', + "gg;": '\U0000226B', + "ggg;": '\U000022D9', + "gimel;": '\U00002137', + "gjcy;": '\U00000453', + "gl;": '\U00002277', + "glE;": '\U00002A92', + "gla;": '\U00002AA5', + "glj;": '\U00002AA4', + "gnE;": '\U00002269', + "gnap;": '\U00002A8A', + "gnapprox;": '\U00002A8A', + "gne;": '\U00002A88', + "gneq;": '\U00002A88', + "gneqq;": '\U00002269', + "gnsim;": '\U000022E7', + "gopf;": '\U0001D558', + "grave;": '\U00000060', + "gscr;": '\U0000210A', + "gsim;": '\U00002273', + "gsime;": '\U00002A8E', + "gsiml;": '\U00002A90', + "gt;": '\U0000003E', + "gtcc;": '\U00002AA7', + "gtcir;": '\U00002A7A', + "gtdot;": '\U000022D7', + "gtlPar;": '\U00002995', + "gtquest;": '\U00002A7C', + "gtrapprox;": '\U00002A86', + "gtrarr;": '\U00002978', + "gtrdot;": '\U000022D7', + "gtreqless;": '\U000022DB', + "gtreqqless;": '\U00002A8C', + "gtrless;": '\U00002277', + "gtrsim;": '\U00002273', + "hArr;": '\U000021D4', + "hairsp;": '\U0000200A', + "half;": '\U000000BD', + "hamilt;": '\U0000210B', + "hardcy;": '\U0000044A', + "harr;": '\U00002194', + "harrcir;": '\U00002948', + "harrw;": '\U000021AD', + "hbar;": '\U0000210F', + "hcirc;": '\U00000125', + "hearts;": '\U00002665', + "heartsuit;": '\U00002665', + "hellip;": '\U00002026', + "hercon;": '\U000022B9', + "hfr;": '\U0001D525', + "hksearow;": '\U00002925', + "hkswarow;": '\U00002926', + "hoarr;": '\U000021FF', + "homtht;": '\U0000223B', + "hookleftarrow;": '\U000021A9', + "hookrightarrow;": '\U000021AA', + "hopf;": '\U0001D559', + "horbar;": '\U00002015', + "hscr;": '\U0001D4BD', + "hslash;": '\U0000210F', + "hstrok;": '\U00000127', + "hybull;": '\U00002043', + "hyphen;": '\U00002010', + "iacute;": '\U000000ED', + "ic;": '\U00002063', + "icirc;": '\U000000EE', + "icy;": '\U00000438', + "iecy;": '\U00000435', + "iexcl;": '\U000000A1', + "iff;": '\U000021D4', + "ifr;": '\U0001D526', + "igrave;": '\U000000EC', + "ii;": '\U00002148', + "iiiint;": '\U00002A0C', + "iiint;": '\U0000222D', + "iinfin;": '\U000029DC', + "iiota;": '\U00002129', + "ijlig;": '\U00000133', + "imacr;": '\U0000012B', + "image;": '\U00002111', + "imagline;": '\U00002110', + "imagpart;": '\U00002111', + "imath;": '\U00000131', + "imof;": '\U000022B7', + "imped;": '\U000001B5', + "in;": '\U00002208', + "incare;": '\U00002105', + "infin;": '\U0000221E', + "infintie;": '\U000029DD', + "inodot;": '\U00000131', + "int;": '\U0000222B', + "intcal;": '\U000022BA', + "integers;": '\U00002124', + "intercal;": '\U000022BA', + "intlarhk;": '\U00002A17', + "intprod;": '\U00002A3C', + "iocy;": '\U00000451', + "iogon;": '\U0000012F', + "iopf;": '\U0001D55A', + "iota;": '\U000003B9', + "iprod;": '\U00002A3C', + "iquest;": '\U000000BF', + "iscr;": '\U0001D4BE', + "isin;": '\U00002208', + "isinE;": '\U000022F9', + "isindot;": '\U000022F5', + "isins;": '\U000022F4', + "isinsv;": '\U000022F3', + "isinv;": '\U00002208', + "it;": '\U00002062', + "itilde;": '\U00000129', + "iukcy;": '\U00000456', + "iuml;": '\U000000EF', + "jcirc;": '\U00000135', + "jcy;": '\U00000439', + "jfr;": '\U0001D527', + "jmath;": '\U00000237', + "jopf;": '\U0001D55B', + "jscr;": '\U0001D4BF', + "jsercy;": '\U00000458', + "jukcy;": '\U00000454', + "kappa;": '\U000003BA', + "kappav;": '\U000003F0', + "kcedil;": '\U00000137', + "kcy;": '\U0000043A', + "kfr;": '\U0001D528', + "kgreen;": '\U00000138', + "khcy;": '\U00000445', + "kjcy;": '\U0000045C', + "kopf;": '\U0001D55C', + "kscr;": '\U0001D4C0', + "lAarr;": '\U000021DA', + "lArr;": '\U000021D0', + "lAtail;": '\U0000291B', + "lBarr;": '\U0000290E', + "lE;": '\U00002266', + "lEg;": '\U00002A8B', + "lHar;": '\U00002962', + "lacute;": '\U0000013A', + "laemptyv;": '\U000029B4', + "lagran;": '\U00002112', + "lambda;": '\U000003BB', + "lang;": '\U000027E8', + "langd;": '\U00002991', + "langle;": '\U000027E8', + "lap;": '\U00002A85', + "laquo;": '\U000000AB', + "larr;": '\U00002190', + "larrb;": '\U000021E4', + "larrbfs;": '\U0000291F', + "larrfs;": '\U0000291D', + "larrhk;": '\U000021A9', + "larrlp;": '\U000021AB', + "larrpl;": '\U00002939', + "larrsim;": '\U00002973', + "larrtl;": '\U000021A2', + "lat;": '\U00002AAB', + "latail;": '\U00002919', + "late;": '\U00002AAD', + "lbarr;": '\U0000290C', + "lbbrk;": '\U00002772', + "lbrace;": '\U0000007B', + "lbrack;": '\U0000005B', + "lbrke;": '\U0000298B', + "lbrksld;": '\U0000298F', + "lbrkslu;": '\U0000298D', + "lcaron;": '\U0000013E', + "lcedil;": '\U0000013C', + "lceil;": '\U00002308', + "lcub;": '\U0000007B', + "lcy;": '\U0000043B', + "ldca;": '\U00002936', + "ldquo;": '\U0000201C', + "ldquor;": '\U0000201E', + "ldrdhar;": '\U00002967', + "ldrushar;": '\U0000294B', + "ldsh;": '\U000021B2', + "le;": '\U00002264', + "leftarrow;": '\U00002190', + "leftarrowtail;": '\U000021A2', + "leftharpoondown;": '\U000021BD', + "leftharpoonup;": '\U000021BC', + "leftleftarrows;": '\U000021C7', + "leftrightarrow;": '\U00002194', + "leftrightarrows;": '\U000021C6', + "leftrightharpoons;": '\U000021CB', + "leftrightsquigarrow;": '\U000021AD', + "leftthreetimes;": '\U000022CB', + "leg;": '\U000022DA', + "leq;": '\U00002264', + "leqq;": '\U00002266', + "leqslant;": '\U00002A7D', + "les;": '\U00002A7D', + "lescc;": '\U00002AA8', + "lesdot;": '\U00002A7F', + "lesdoto;": '\U00002A81', + "lesdotor;": '\U00002A83', + "lesges;": '\U00002A93', + "lessapprox;": '\U00002A85', + "lessdot;": '\U000022D6', + "lesseqgtr;": '\U000022DA', + "lesseqqgtr;": '\U00002A8B', + "lessgtr;": '\U00002276', + "lesssim;": '\U00002272', + "lfisht;": '\U0000297C', + "lfloor;": '\U0000230A', + "lfr;": '\U0001D529', + "lg;": '\U00002276', + "lgE;": '\U00002A91', + "lhard;": '\U000021BD', + "lharu;": '\U000021BC', + "lharul;": '\U0000296A', + "lhblk;": '\U00002584', + "ljcy;": '\U00000459', + "ll;": '\U0000226A', + "llarr;": '\U000021C7', + "llcorner;": '\U0000231E', + "llhard;": '\U0000296B', + "lltri;": '\U000025FA', + "lmidot;": '\U00000140', + "lmoust;": '\U000023B0', + "lmoustache;": '\U000023B0', + "lnE;": '\U00002268', + "lnap;": '\U00002A89', + "lnapprox;": '\U00002A89', + "lne;": '\U00002A87', + "lneq;": '\U00002A87', + "lneqq;": '\U00002268', + "lnsim;": '\U000022E6', + "loang;": '\U000027EC', + "loarr;": '\U000021FD', + "lobrk;": '\U000027E6', + "longleftarrow;": '\U000027F5', + "longleftrightarrow;": '\U000027F7', + "longmapsto;": '\U000027FC', + "longrightarrow;": '\U000027F6', + "looparrowleft;": '\U000021AB', + "looparrowright;": '\U000021AC', + "lopar;": '\U00002985', + "lopf;": '\U0001D55D', + "loplus;": '\U00002A2D', + "lotimes;": '\U00002A34', + "lowast;": '\U00002217', + "lowbar;": '\U0000005F', + "loz;": '\U000025CA', + "lozenge;": '\U000025CA', + "lozf;": '\U000029EB', + "lpar;": '\U00000028', + "lparlt;": '\U00002993', + "lrarr;": '\U000021C6', + "lrcorner;": '\U0000231F', + "lrhar;": '\U000021CB', + "lrhard;": '\U0000296D', + "lrm;": '\U0000200E', + "lrtri;": '\U000022BF', + "lsaquo;": '\U00002039', + "lscr;": '\U0001D4C1', + "lsh;": '\U000021B0', + "lsim;": '\U00002272', + "lsime;": '\U00002A8D', + "lsimg;": '\U00002A8F', + "lsqb;": '\U0000005B', + "lsquo;": '\U00002018', + "lsquor;": '\U0000201A', + "lstrok;": '\U00000142', + "lt;": '\U0000003C', + "ltcc;": '\U00002AA6', + "ltcir;": '\U00002A79', + "ltdot;": '\U000022D6', + "lthree;": '\U000022CB', + "ltimes;": '\U000022C9', + "ltlarr;": '\U00002976', + "ltquest;": '\U00002A7B', + "ltrPar;": '\U00002996', + "ltri;": '\U000025C3', + "ltrie;": '\U000022B4', + "ltrif;": '\U000025C2', + "lurdshar;": '\U0000294A', + "luruhar;": '\U00002966', + "mDDot;": '\U0000223A', + "macr;": '\U000000AF', + "male;": '\U00002642', + "malt;": '\U00002720', + "maltese;": '\U00002720', + "map;": '\U000021A6', + "mapsto;": '\U000021A6', + "mapstodown;": '\U000021A7', + "mapstoleft;": '\U000021A4', + "mapstoup;": '\U000021A5', + "marker;": '\U000025AE', + "mcomma;": '\U00002A29', + "mcy;": '\U0000043C', + "mdash;": '\U00002014', + "measuredangle;": '\U00002221', + "mfr;": '\U0001D52A', + "mho;": '\U00002127', + "micro;": '\U000000B5', + "mid;": '\U00002223', + "midast;": '\U0000002A', + "midcir;": '\U00002AF0', + "middot;": '\U000000B7', + "minus;": '\U00002212', + "minusb;": '\U0000229F', + "minusd;": '\U00002238', + "minusdu;": '\U00002A2A', + "mlcp;": '\U00002ADB', + "mldr;": '\U00002026', + "mnplus;": '\U00002213', + "models;": '\U000022A7', + "mopf;": '\U0001D55E', + "mp;": '\U00002213', + "mscr;": '\U0001D4C2', + "mstpos;": '\U0000223E', + "mu;": '\U000003BC', + "multimap;": '\U000022B8', + "mumap;": '\U000022B8', + "nLeftarrow;": '\U000021CD', + "nLeftrightarrow;": '\U000021CE', + "nRightarrow;": '\U000021CF', + "nVDash;": '\U000022AF', + "nVdash;": '\U000022AE', + "nabla;": '\U00002207', + "nacute;": '\U00000144', + "nap;": '\U00002249', + "napos;": '\U00000149', + "napprox;": '\U00002249', + "natur;": '\U0000266E', + "natural;": '\U0000266E', + "naturals;": '\U00002115', + "nbsp;": '\U000000A0', + "ncap;": '\U00002A43', + "ncaron;": '\U00000148', + "ncedil;": '\U00000146', + "ncong;": '\U00002247', + "ncup;": '\U00002A42', + "ncy;": '\U0000043D', + "ndash;": '\U00002013', + "ne;": '\U00002260', + "neArr;": '\U000021D7', + "nearhk;": '\U00002924', + "nearr;": '\U00002197', + "nearrow;": '\U00002197', + "nequiv;": '\U00002262', + "nesear;": '\U00002928', + "nexist;": '\U00002204', + "nexists;": '\U00002204', + "nfr;": '\U0001D52B', + "nge;": '\U00002271', + "ngeq;": '\U00002271', + "ngsim;": '\U00002275', + "ngt;": '\U0000226F', + "ngtr;": '\U0000226F', + "nhArr;": '\U000021CE', + "nharr;": '\U000021AE', + "nhpar;": '\U00002AF2', + "ni;": '\U0000220B', + "nis;": '\U000022FC', + "nisd;": '\U000022FA', + "niv;": '\U0000220B', + "njcy;": '\U0000045A', + "nlArr;": '\U000021CD', + "nlarr;": '\U0000219A', + "nldr;": '\U00002025', + "nle;": '\U00002270', + "nleftarrow;": '\U0000219A', + "nleftrightarrow;": '\U000021AE', + "nleq;": '\U00002270', + "nless;": '\U0000226E', + "nlsim;": '\U00002274', + "nlt;": '\U0000226E', + "nltri;": '\U000022EA', + "nltrie;": '\U000022EC', + "nmid;": '\U00002224', + "nopf;": '\U0001D55F', + "not;": '\U000000AC', + "notin;": '\U00002209', + "notinva;": '\U00002209', + "notinvb;": '\U000022F7', + "notinvc;": '\U000022F6', + "notni;": '\U0000220C', + "notniva;": '\U0000220C', + "notnivb;": '\U000022FE', + "notnivc;": '\U000022FD', + "npar;": '\U00002226', + "nparallel;": '\U00002226', + "npolint;": '\U00002A14', + "npr;": '\U00002280', + "nprcue;": '\U000022E0', + "nprec;": '\U00002280', + "nrArr;": '\U000021CF', + "nrarr;": '\U0000219B', + "nrightarrow;": '\U0000219B', + "nrtri;": '\U000022EB', + "nrtrie;": '\U000022ED', + "nsc;": '\U00002281', + "nsccue;": '\U000022E1', + "nscr;": '\U0001D4C3', + "nshortmid;": '\U00002224', + "nshortparallel;": '\U00002226', + "nsim;": '\U00002241', + "nsime;": '\U00002244', + "nsimeq;": '\U00002244', + "nsmid;": '\U00002224', + "nspar;": '\U00002226', + "nsqsube;": '\U000022E2', + "nsqsupe;": '\U000022E3', + "nsub;": '\U00002284', + "nsube;": '\U00002288', + "nsubseteq;": '\U00002288', + "nsucc;": '\U00002281', + "nsup;": '\U00002285', + "nsupe;": '\U00002289', + "nsupseteq;": '\U00002289', + "ntgl;": '\U00002279', + "ntilde;": '\U000000F1', + "ntlg;": '\U00002278', + "ntriangleleft;": '\U000022EA', + "ntrianglelefteq;": '\U000022EC', + "ntriangleright;": '\U000022EB', + "ntrianglerighteq;": '\U000022ED', + "nu;": '\U000003BD', + "num;": '\U00000023', + "numero;": '\U00002116', + "numsp;": '\U00002007', + "nvDash;": '\U000022AD', + "nvHarr;": '\U00002904', + "nvdash;": '\U000022AC', + "nvinfin;": '\U000029DE', + "nvlArr;": '\U00002902', + "nvrArr;": '\U00002903', + "nwArr;": '\U000021D6', + "nwarhk;": '\U00002923', + "nwarr;": '\U00002196', + "nwarrow;": '\U00002196', + "nwnear;": '\U00002927', + "oS;": '\U000024C8', + "oacute;": '\U000000F3', + "oast;": '\U0000229B', + "ocir;": '\U0000229A', + "ocirc;": '\U000000F4', + "ocy;": '\U0000043E', + "odash;": '\U0000229D', + "odblac;": '\U00000151', + "odiv;": '\U00002A38', + "odot;": '\U00002299', + "odsold;": '\U000029BC', + "oelig;": '\U00000153', + "ofcir;": '\U000029BF', + "ofr;": '\U0001D52C', + "ogon;": '\U000002DB', + "ograve;": '\U000000F2', + "ogt;": '\U000029C1', + "ohbar;": '\U000029B5', + "ohm;": '\U000003A9', + "oint;": '\U0000222E', + "olarr;": '\U000021BA', + "olcir;": '\U000029BE', + "olcross;": '\U000029BB', + "oline;": '\U0000203E', + "olt;": '\U000029C0', + "omacr;": '\U0000014D', + "omega;": '\U000003C9', + "omicron;": '\U000003BF', + "omid;": '\U000029B6', + "ominus;": '\U00002296', + "oopf;": '\U0001D560', + "opar;": '\U000029B7', + "operp;": '\U000029B9', + "oplus;": '\U00002295', + "or;": '\U00002228', + "orarr;": '\U000021BB', + "ord;": '\U00002A5D', + "order;": '\U00002134', + "orderof;": '\U00002134', + "ordf;": '\U000000AA', + "ordm;": '\U000000BA', + "origof;": '\U000022B6', + "oror;": '\U00002A56', + "orslope;": '\U00002A57', + "orv;": '\U00002A5B', + "oscr;": '\U00002134', + "oslash;": '\U000000F8', + "osol;": '\U00002298', + "otilde;": '\U000000F5', + "otimes;": '\U00002297', + "otimesas;": '\U00002A36', + "ouml;": '\U000000F6', + "ovbar;": '\U0000233D', + "par;": '\U00002225', + "para;": '\U000000B6', + "parallel;": '\U00002225', + "parsim;": '\U00002AF3', + "parsl;": '\U00002AFD', + "part;": '\U00002202', + "pcy;": '\U0000043F', + "percnt;": '\U00000025', + "period;": '\U0000002E', + "permil;": '\U00002030', + "perp;": '\U000022A5', + "pertenk;": '\U00002031', + "pfr;": '\U0001D52D', + "phi;": '\U000003C6', + "phiv;": '\U000003D5', + "phmmat;": '\U00002133', + "phone;": '\U0000260E', + "pi;": '\U000003C0', + "pitchfork;": '\U000022D4', + "piv;": '\U000003D6', + "planck;": '\U0000210F', + "planckh;": '\U0000210E', + "plankv;": '\U0000210F', + "plus;": '\U0000002B', + "plusacir;": '\U00002A23', + "plusb;": '\U0000229E', + "pluscir;": '\U00002A22', + "plusdo;": '\U00002214', + "plusdu;": '\U00002A25', + "pluse;": '\U00002A72', + "plusmn;": '\U000000B1', + "plussim;": '\U00002A26', + "plustwo;": '\U00002A27', + "pm;": '\U000000B1', + "pointint;": '\U00002A15', + "popf;": '\U0001D561', + "pound;": '\U000000A3', + "pr;": '\U0000227A', + "prE;": '\U00002AB3', + "prap;": '\U00002AB7', + "prcue;": '\U0000227C', + "pre;": '\U00002AAF', + "prec;": '\U0000227A', + "precapprox;": '\U00002AB7', + "preccurlyeq;": '\U0000227C', + "preceq;": '\U00002AAF', + "precnapprox;": '\U00002AB9', + "precneqq;": '\U00002AB5', + "precnsim;": '\U000022E8', + "precsim;": '\U0000227E', + "prime;": '\U00002032', + "primes;": '\U00002119', + "prnE;": '\U00002AB5', + "prnap;": '\U00002AB9', + "prnsim;": '\U000022E8', + "prod;": '\U0000220F', + "profalar;": '\U0000232E', + "profline;": '\U00002312', + "profsurf;": '\U00002313', + "prop;": '\U0000221D', + "propto;": '\U0000221D', + "prsim;": '\U0000227E', + "prurel;": '\U000022B0', + "pscr;": '\U0001D4C5', + "psi;": '\U000003C8', + "puncsp;": '\U00002008', + "qfr;": '\U0001D52E', + "qint;": '\U00002A0C', + "qopf;": '\U0001D562', + "qprime;": '\U00002057', + "qscr;": '\U0001D4C6', + "quaternions;": '\U0000210D', + "quatint;": '\U00002A16', + "quest;": '\U0000003F', + "questeq;": '\U0000225F', + "quot;": '\U00000022', + "rAarr;": '\U000021DB', + "rArr;": '\U000021D2', + "rAtail;": '\U0000291C', + "rBarr;": '\U0000290F', + "rHar;": '\U00002964', + "racute;": '\U00000155', + "radic;": '\U0000221A', + "raemptyv;": '\U000029B3', + "rang;": '\U000027E9', + "rangd;": '\U00002992', + "range;": '\U000029A5', + "rangle;": '\U000027E9', + "raquo;": '\U000000BB', + "rarr;": '\U00002192', + "rarrap;": '\U00002975', + "rarrb;": '\U000021E5', + "rarrbfs;": '\U00002920', + "rarrc;": '\U00002933', + "rarrfs;": '\U0000291E', + "rarrhk;": '\U000021AA', + "rarrlp;": '\U000021AC', + "rarrpl;": '\U00002945', + "rarrsim;": '\U00002974', + "rarrtl;": '\U000021A3', + "rarrw;": '\U0000219D', + "ratail;": '\U0000291A', + "ratio;": '\U00002236', + "rationals;": '\U0000211A', + "rbarr;": '\U0000290D', + "rbbrk;": '\U00002773', + "rbrace;": '\U0000007D', + "rbrack;": '\U0000005D', + "rbrke;": '\U0000298C', + "rbrksld;": '\U0000298E', + "rbrkslu;": '\U00002990', + "rcaron;": '\U00000159', + "rcedil;": '\U00000157', + "rceil;": '\U00002309', + "rcub;": '\U0000007D', + "rcy;": '\U00000440', + "rdca;": '\U00002937', + "rdldhar;": '\U00002969', + "rdquo;": '\U0000201D', + "rdquor;": '\U0000201D', + "rdsh;": '\U000021B3', + "real;": '\U0000211C', + "realine;": '\U0000211B', + "realpart;": '\U0000211C', + "reals;": '\U0000211D', + "rect;": '\U000025AD', + "reg;": '\U000000AE', + "rfisht;": '\U0000297D', + "rfloor;": '\U0000230B', + "rfr;": '\U0001D52F', + "rhard;": '\U000021C1', + "rharu;": '\U000021C0', + "rharul;": '\U0000296C', + "rho;": '\U000003C1', + "rhov;": '\U000003F1', + "rightarrow;": '\U00002192', + "rightarrowtail;": '\U000021A3', + "rightharpoondown;": '\U000021C1', + "rightharpoonup;": '\U000021C0', + "rightleftarrows;": '\U000021C4', + "rightleftharpoons;": '\U000021CC', + "rightrightarrows;": '\U000021C9', + "rightsquigarrow;": '\U0000219D', + "rightthreetimes;": '\U000022CC', + "ring;": '\U000002DA', + "risingdotseq;": '\U00002253', + "rlarr;": '\U000021C4', + "rlhar;": '\U000021CC', + "rlm;": '\U0000200F', + "rmoust;": '\U000023B1', + "rmoustache;": '\U000023B1', + "rnmid;": '\U00002AEE', + "roang;": '\U000027ED', + "roarr;": '\U000021FE', + "robrk;": '\U000027E7', + "ropar;": '\U00002986', + "ropf;": '\U0001D563', + "roplus;": '\U00002A2E', + "rotimes;": '\U00002A35', + "rpar;": '\U00000029', + "rpargt;": '\U00002994', + "rppolint;": '\U00002A12', + "rrarr;": '\U000021C9', + "rsaquo;": '\U0000203A', + "rscr;": '\U0001D4C7', + "rsh;": '\U000021B1', + "rsqb;": '\U0000005D', + "rsquo;": '\U00002019', + "rsquor;": '\U00002019', + "rthree;": '\U000022CC', + "rtimes;": '\U000022CA', + "rtri;": '\U000025B9', + "rtrie;": '\U000022B5', + "rtrif;": '\U000025B8', + "rtriltri;": '\U000029CE', + "ruluhar;": '\U00002968', + "rx;": '\U0000211E', + "sacute;": '\U0000015B', + "sbquo;": '\U0000201A', + "sc;": '\U0000227B', + "scE;": '\U00002AB4', + "scap;": '\U00002AB8', + "scaron;": '\U00000161', + "sccue;": '\U0000227D', + "sce;": '\U00002AB0', + "scedil;": '\U0000015F', + "scirc;": '\U0000015D', + "scnE;": '\U00002AB6', + "scnap;": '\U00002ABA', + "scnsim;": '\U000022E9', + "scpolint;": '\U00002A13', + "scsim;": '\U0000227F', + "scy;": '\U00000441', + "sdot;": '\U000022C5', + "sdotb;": '\U000022A1', + "sdote;": '\U00002A66', + "seArr;": '\U000021D8', + "searhk;": '\U00002925', + "searr;": '\U00002198', + "searrow;": '\U00002198', + "sect;": '\U000000A7', + "semi;": '\U0000003B', + "seswar;": '\U00002929', + "setminus;": '\U00002216', + "setmn;": '\U00002216', + "sext;": '\U00002736', + "sfr;": '\U0001D530', + "sfrown;": '\U00002322', + "sharp;": '\U0000266F', + "shchcy;": '\U00000449', + "shcy;": '\U00000448', + "shortmid;": '\U00002223', + "shortparallel;": '\U00002225', + "shy;": '\U000000AD', + "sigma;": '\U000003C3', + "sigmaf;": '\U000003C2', + "sigmav;": '\U000003C2', + "sim;": '\U0000223C', + "simdot;": '\U00002A6A', + "sime;": '\U00002243', + "simeq;": '\U00002243', + "simg;": '\U00002A9E', + "simgE;": '\U00002AA0', + "siml;": '\U00002A9D', + "simlE;": '\U00002A9F', + "simne;": '\U00002246', + "simplus;": '\U00002A24', + "simrarr;": '\U00002972', + "slarr;": '\U00002190', + "smallsetminus;": '\U00002216', + "smashp;": '\U00002A33', + "smeparsl;": '\U000029E4', + "smid;": '\U00002223', + "smile;": '\U00002323', + "smt;": '\U00002AAA', + "smte;": '\U00002AAC', + "softcy;": '\U0000044C', + "sol;": '\U0000002F', + "solb;": '\U000029C4', + "solbar;": '\U0000233F', + "sopf;": '\U0001D564', + "spades;": '\U00002660', + "spadesuit;": '\U00002660', + "spar;": '\U00002225', + "sqcap;": '\U00002293', + "sqcup;": '\U00002294', + "sqsub;": '\U0000228F', + "sqsube;": '\U00002291', + "sqsubset;": '\U0000228F', + "sqsubseteq;": '\U00002291', + "sqsup;": '\U00002290', + "sqsupe;": '\U00002292', + "sqsupset;": '\U00002290', + "sqsupseteq;": '\U00002292', + "squ;": '\U000025A1', + "square;": '\U000025A1', + "squarf;": '\U000025AA', + "squf;": '\U000025AA', + "srarr;": '\U00002192', + "sscr;": '\U0001D4C8', + "ssetmn;": '\U00002216', + "ssmile;": '\U00002323', + "sstarf;": '\U000022C6', + "star;": '\U00002606', + "starf;": '\U00002605', + "straightepsilon;": '\U000003F5', + "straightphi;": '\U000003D5', + "strns;": '\U000000AF', + "sub;": '\U00002282', + "subE;": '\U00002AC5', + "subdot;": '\U00002ABD', + "sube;": '\U00002286', + "subedot;": '\U00002AC3', + "submult;": '\U00002AC1', + "subnE;": '\U00002ACB', + "subne;": '\U0000228A', + "subplus;": '\U00002ABF', + "subrarr;": '\U00002979', + "subset;": '\U00002282', + "subseteq;": '\U00002286', + "subseteqq;": '\U00002AC5', + "subsetneq;": '\U0000228A', + "subsetneqq;": '\U00002ACB', + "subsim;": '\U00002AC7', + "subsub;": '\U00002AD5', + "subsup;": '\U00002AD3', + "succ;": '\U0000227B', + "succapprox;": '\U00002AB8', + "succcurlyeq;": '\U0000227D', + "succeq;": '\U00002AB0', + "succnapprox;": '\U00002ABA', + "succneqq;": '\U00002AB6', + "succnsim;": '\U000022E9', + "succsim;": '\U0000227F', + "sum;": '\U00002211', + "sung;": '\U0000266A', + "sup;": '\U00002283', + "sup1;": '\U000000B9', + "sup2;": '\U000000B2', + "sup3;": '\U000000B3', + "supE;": '\U00002AC6', + "supdot;": '\U00002ABE', + "supdsub;": '\U00002AD8', + "supe;": '\U00002287', + "supedot;": '\U00002AC4', + "suphsol;": '\U000027C9', + "suphsub;": '\U00002AD7', + "suplarr;": '\U0000297B', + "supmult;": '\U00002AC2', + "supnE;": '\U00002ACC', + "supne;": '\U0000228B', + "supplus;": '\U00002AC0', + "supset;": '\U00002283', + "supseteq;": '\U00002287', + "supseteqq;": '\U00002AC6', + "supsetneq;": '\U0000228B', + "supsetneqq;": '\U00002ACC', + "supsim;": '\U00002AC8', + "supsub;": '\U00002AD4', + "supsup;": '\U00002AD6', + "swArr;": '\U000021D9', + "swarhk;": '\U00002926', + "swarr;": '\U00002199', + "swarrow;": '\U00002199', + "swnwar;": '\U0000292A', + "szlig;": '\U000000DF', + "target;": '\U00002316', + "tau;": '\U000003C4', + "tbrk;": '\U000023B4', + "tcaron;": '\U00000165', + "tcedil;": '\U00000163', + "tcy;": '\U00000442', + "tdot;": '\U000020DB', + "telrec;": '\U00002315', + "tfr;": '\U0001D531', + "there4;": '\U00002234', + "therefore;": '\U00002234', + "theta;": '\U000003B8', + "thetasym;": '\U000003D1', + "thetav;": '\U000003D1', + "thickapprox;": '\U00002248', + "thicksim;": '\U0000223C', + "thinsp;": '\U00002009', + "thkap;": '\U00002248', + "thksim;": '\U0000223C', + "thorn;": '\U000000FE', + "tilde;": '\U000002DC', + "times;": '\U000000D7', + "timesb;": '\U000022A0', + "timesbar;": '\U00002A31', + "timesd;": '\U00002A30', + "tint;": '\U0000222D', + "toea;": '\U00002928', + "top;": '\U000022A4', + "topbot;": '\U00002336', + "topcir;": '\U00002AF1', + "topf;": '\U0001D565', + "topfork;": '\U00002ADA', + "tosa;": '\U00002929', + "tprime;": '\U00002034', + "trade;": '\U00002122', + "triangle;": '\U000025B5', + "triangledown;": '\U000025BF', + "triangleleft;": '\U000025C3', + "trianglelefteq;": '\U000022B4', + "triangleq;": '\U0000225C', + "triangleright;": '\U000025B9', + "trianglerighteq;": '\U000022B5', + "tridot;": '\U000025EC', + "trie;": '\U0000225C', + "triminus;": '\U00002A3A', + "triplus;": '\U00002A39', + "trisb;": '\U000029CD', + "tritime;": '\U00002A3B', + "trpezium;": '\U000023E2', + "tscr;": '\U0001D4C9', + "tscy;": '\U00000446', + "tshcy;": '\U0000045B', + "tstrok;": '\U00000167', + "twixt;": '\U0000226C', + "twoheadleftarrow;": '\U0000219E', + "twoheadrightarrow;": '\U000021A0', + "uArr;": '\U000021D1', + "uHar;": '\U00002963', + "uacute;": '\U000000FA', + "uarr;": '\U00002191', + "ubrcy;": '\U0000045E', + "ubreve;": '\U0000016D', + "ucirc;": '\U000000FB', + "ucy;": '\U00000443', + "udarr;": '\U000021C5', + "udblac;": '\U00000171', + "udhar;": '\U0000296E', + "ufisht;": '\U0000297E', + "ufr;": '\U0001D532', + "ugrave;": '\U000000F9', + "uharl;": '\U000021BF', + "uharr;": '\U000021BE', + "uhblk;": '\U00002580', + "ulcorn;": '\U0000231C', + "ulcorner;": '\U0000231C', + "ulcrop;": '\U0000230F', + "ultri;": '\U000025F8', + "umacr;": '\U0000016B', + "uml;": '\U000000A8', + "uogon;": '\U00000173', + "uopf;": '\U0001D566', + "uparrow;": '\U00002191', + "updownarrow;": '\U00002195', + "upharpoonleft;": '\U000021BF', + "upharpoonright;": '\U000021BE', + "uplus;": '\U0000228E', + "upsi;": '\U000003C5', + "upsih;": '\U000003D2', + "upsilon;": '\U000003C5', + "upuparrows;": '\U000021C8', + "urcorn;": '\U0000231D', + "urcorner;": '\U0000231D', + "urcrop;": '\U0000230E', + "uring;": '\U0000016F', + "urtri;": '\U000025F9', + "uscr;": '\U0001D4CA', + "utdot;": '\U000022F0', + "utilde;": '\U00000169', + "utri;": '\U000025B5', + "utrif;": '\U000025B4', + "uuarr;": '\U000021C8', + "uuml;": '\U000000FC', + "uwangle;": '\U000029A7', + "vArr;": '\U000021D5', + "vBar;": '\U00002AE8', + "vBarv;": '\U00002AE9', + "vDash;": '\U000022A8', + "vangrt;": '\U0000299C', + "varepsilon;": '\U000003F5', + "varkappa;": '\U000003F0', + "varnothing;": '\U00002205', + "varphi;": '\U000003D5', + "varpi;": '\U000003D6', + "varpropto;": '\U0000221D', + "varr;": '\U00002195', + "varrho;": '\U000003F1', + "varsigma;": '\U000003C2', + "vartheta;": '\U000003D1', + "vartriangleleft;": '\U000022B2', + "vartriangleright;": '\U000022B3', + "vcy;": '\U00000432', + "vdash;": '\U000022A2', + "vee;": '\U00002228', + "veebar;": '\U000022BB', + "veeeq;": '\U0000225A', + "vellip;": '\U000022EE', + "verbar;": '\U0000007C', + "vert;": '\U0000007C', + "vfr;": '\U0001D533', + "vltri;": '\U000022B2', + "vopf;": '\U0001D567', + "vprop;": '\U0000221D', + "vrtri;": '\U000022B3', + "vscr;": '\U0001D4CB', + "vzigzag;": '\U0000299A', + "wcirc;": '\U00000175', + "wedbar;": '\U00002A5F', + "wedge;": '\U00002227', + "wedgeq;": '\U00002259', + "weierp;": '\U00002118', + "wfr;": '\U0001D534', + "wopf;": '\U0001D568', + "wp;": '\U00002118', + "wr;": '\U00002240', + "wreath;": '\U00002240', + "wscr;": '\U0001D4CC', + "xcap;": '\U000022C2', + "xcirc;": '\U000025EF', + "xcup;": '\U000022C3', + "xdtri;": '\U000025BD', + "xfr;": '\U0001D535', + "xhArr;": '\U000027FA', + "xharr;": '\U000027F7', + "xi;": '\U000003BE', + "xlArr;": '\U000027F8', + "xlarr;": '\U000027F5', + "xmap;": '\U000027FC', + "xnis;": '\U000022FB', + "xodot;": '\U00002A00', + "xopf;": '\U0001D569', + "xoplus;": '\U00002A01', + "xotime;": '\U00002A02', + "xrArr;": '\U000027F9', + "xrarr;": '\U000027F6', + "xscr;": '\U0001D4CD', + "xsqcup;": '\U00002A06', + "xuplus;": '\U00002A04', + "xutri;": '\U000025B3', + "xvee;": '\U000022C1', + "xwedge;": '\U000022C0', + "yacute;": '\U000000FD', + "yacy;": '\U0000044F', + "ycirc;": '\U00000177', + "ycy;": '\U0000044B', + "yen;": '\U000000A5', + "yfr;": '\U0001D536', + "yicy;": '\U00000457', + "yopf;": '\U0001D56A', + "yscr;": '\U0001D4CE', + "yucy;": '\U0000044E', + "yuml;": '\U000000FF', + "zacute;": '\U0000017A', + "zcaron;": '\U0000017E', + "zcy;": '\U00000437', + "zdot;": '\U0000017C', + "zeetrf;": '\U00002128', + "zeta;": '\U000003B6', + "zfr;": '\U0001D537', + "zhcy;": '\U00000436', + "zigrarr;": '\U000021DD', + "zopf;": '\U0001D56B', + "zscr;": '\U0001D4CF', + "zwj;": '\U0000200D', + "zwnj;": '\U0000200C', + "AElig": '\U000000C6', + "AMP": '\U00000026', + "Aacute": '\U000000C1', + "Acirc": '\U000000C2', + "Agrave": '\U000000C0', + "Aring": '\U000000C5', + "Atilde": '\U000000C3', + "Auml": '\U000000C4', + "COPY": '\U000000A9', + "Ccedil": '\U000000C7', + "ETH": '\U000000D0', + "Eacute": '\U000000C9', + "Ecirc": '\U000000CA', + "Egrave": '\U000000C8', + "Euml": '\U000000CB', + "GT": '\U0000003E', + "Iacute": '\U000000CD', + "Icirc": '\U000000CE', + "Igrave": '\U000000CC', + "Iuml": '\U000000CF', + "LT": '\U0000003C', + "Ntilde": '\U000000D1', + "Oacute": '\U000000D3', + "Ocirc": '\U000000D4', + "Ograve": '\U000000D2', + "Oslash": '\U000000D8', + "Otilde": '\U000000D5', + "Ouml": '\U000000D6', + "QUOT": '\U00000022', + "REG": '\U000000AE', + "THORN": '\U000000DE', + "Uacute": '\U000000DA', + "Ucirc": '\U000000DB', + "Ugrave": '\U000000D9', + "Uuml": '\U000000DC', + "Yacute": '\U000000DD', + "aacute": '\U000000E1', + "acirc": '\U000000E2', + "acute": '\U000000B4', + "aelig": '\U000000E6', + "agrave": '\U000000E0', + "amp": '\U00000026', + "aring": '\U000000E5', + "atilde": '\U000000E3', + "auml": '\U000000E4', + "brvbar": '\U000000A6', + "ccedil": '\U000000E7', + "cedil": '\U000000B8', + "cent": '\U000000A2', + "copy": '\U000000A9', + "curren": '\U000000A4', + "deg": '\U000000B0', + "divide": '\U000000F7', + "eacute": '\U000000E9', + "ecirc": '\U000000EA', + "egrave": '\U000000E8', + "eth": '\U000000F0', + "euml": '\U000000EB', + "frac12": '\U000000BD', + "frac14": '\U000000BC', + "frac34": '\U000000BE', + "gt": '\U0000003E', + "iacute": '\U000000ED', + "icirc": '\U000000EE', + "iexcl": '\U000000A1', + "igrave": '\U000000EC', + "iquest": '\U000000BF', + "iuml": '\U000000EF', + "laquo": '\U000000AB', + "lt": '\U0000003C', + "macr": '\U000000AF', + "micro": '\U000000B5', + "middot": '\U000000B7', + "nbsp": '\U000000A0', + "not": '\U000000AC', + "ntilde": '\U000000F1', + "oacute": '\U000000F3', + "ocirc": '\U000000F4', + "ograve": '\U000000F2', + "ordf": '\U000000AA', + "ordm": '\U000000BA', + "oslash": '\U000000F8', + "otilde": '\U000000F5', + "ouml": '\U000000F6', + "para": '\U000000B6', + "plusmn": '\U000000B1', + "pound": '\U000000A3', + "quot": '\U00000022', + "raquo": '\U000000BB', + "reg": '\U000000AE', + "sect": '\U000000A7', + "shy": '\U000000AD', + "sup1": '\U000000B9', + "sup2": '\U000000B2', + "sup3": '\U000000B3', + "szlig": '\U000000DF', + "thorn": '\U000000FE', + "times": '\U000000D7', + "uacute": '\U000000FA', + "ucirc": '\U000000FB', + "ugrave": '\U000000F9', + "uml": '\U000000A8', + "uuml": '\U000000FC', + "yacute": '\U000000FD', + "yen": '\U000000A5', + "yuml": '\U000000FF', +} + +// HTML entities that are two unicode codepoints. +var entity2 = map[string][2]rune{ + // TODO(nigeltao): Handle replacements that are wider than their names. + // "nLt;": {'\u226A', '\u20D2'}, + // "nGt;": {'\u226B', '\u20D2'}, + "NotEqualTilde;": {'\u2242', '\u0338'}, + "NotGreaterFullEqual;": {'\u2267', '\u0338'}, + "NotGreaterGreater;": {'\u226B', '\u0338'}, + "NotGreaterSlantEqual;": {'\u2A7E', '\u0338'}, + "NotHumpDownHump;": {'\u224E', '\u0338'}, + "NotHumpEqual;": {'\u224F', '\u0338'}, + "NotLeftTriangleBar;": {'\u29CF', '\u0338'}, + "NotLessLess;": {'\u226A', '\u0338'}, + "NotLessSlantEqual;": {'\u2A7D', '\u0338'}, + "NotNestedGreaterGreater;": {'\u2AA2', '\u0338'}, + "NotNestedLessLess;": {'\u2AA1', '\u0338'}, + "NotPrecedesEqual;": {'\u2AAF', '\u0338'}, + "NotRightTriangleBar;": {'\u29D0', '\u0338'}, + "NotSquareSubset;": {'\u228F', '\u0338'}, + "NotSquareSuperset;": {'\u2290', '\u0338'}, + "NotSubset;": {'\u2282', '\u20D2'}, + "NotSucceedsEqual;": {'\u2AB0', '\u0338'}, + "NotSucceedsTilde;": {'\u227F', '\u0338'}, + "NotSuperset;": {'\u2283', '\u20D2'}, + "ThickSpace;": {'\u205F', '\u200A'}, + "acE;": {'\u223E', '\u0333'}, + "bne;": {'\u003D', '\u20E5'}, + "bnequiv;": {'\u2261', '\u20E5'}, + "caps;": {'\u2229', '\uFE00'}, + "cups;": {'\u222A', '\uFE00'}, + "fjlig;": {'\u0066', '\u006A'}, + "gesl;": {'\u22DB', '\uFE00'}, + "gvertneqq;": {'\u2269', '\uFE00'}, + "gvnE;": {'\u2269', '\uFE00'}, + "lates;": {'\u2AAD', '\uFE00'}, + "lesg;": {'\u22DA', '\uFE00'}, + "lvertneqq;": {'\u2268', '\uFE00'}, + "lvnE;": {'\u2268', '\uFE00'}, + "nGg;": {'\u22D9', '\u0338'}, + "nGtv;": {'\u226B', '\u0338'}, + "nLl;": {'\u22D8', '\u0338'}, + "nLtv;": {'\u226A', '\u0338'}, + "nang;": {'\u2220', '\u20D2'}, + "napE;": {'\u2A70', '\u0338'}, + "napid;": {'\u224B', '\u0338'}, + "nbump;": {'\u224E', '\u0338'}, + "nbumpe;": {'\u224F', '\u0338'}, + "ncongdot;": {'\u2A6D', '\u0338'}, + "nedot;": {'\u2250', '\u0338'}, + "nesim;": {'\u2242', '\u0338'}, + "ngE;": {'\u2267', '\u0338'}, + "ngeqq;": {'\u2267', '\u0338'}, + "ngeqslant;": {'\u2A7E', '\u0338'}, + "nges;": {'\u2A7E', '\u0338'}, + "nlE;": {'\u2266', '\u0338'}, + "nleqq;": {'\u2266', '\u0338'}, + "nleqslant;": {'\u2A7D', '\u0338'}, + "nles;": {'\u2A7D', '\u0338'}, + "notinE;": {'\u22F9', '\u0338'}, + "notindot;": {'\u22F5', '\u0338'}, + "nparsl;": {'\u2AFD', '\u20E5'}, + "npart;": {'\u2202', '\u0338'}, + "npre;": {'\u2AAF', '\u0338'}, + "npreceq;": {'\u2AAF', '\u0338'}, + "nrarrc;": {'\u2933', '\u0338'}, + "nrarrw;": {'\u219D', '\u0338'}, + "nsce;": {'\u2AB0', '\u0338'}, + "nsubE;": {'\u2AC5', '\u0338'}, + "nsubset;": {'\u2282', '\u20D2'}, + "nsubseteqq;": {'\u2AC5', '\u0338'}, + "nsucceq;": {'\u2AB0', '\u0338'}, + "nsupE;": {'\u2AC6', '\u0338'}, + "nsupset;": {'\u2283', '\u20D2'}, + "nsupseteqq;": {'\u2AC6', '\u0338'}, + "nvap;": {'\u224D', '\u20D2'}, + "nvge;": {'\u2265', '\u20D2'}, + "nvgt;": {'\u003E', '\u20D2'}, + "nvle;": {'\u2264', '\u20D2'}, + "nvlt;": {'\u003C', '\u20D2'}, + "nvltrie;": {'\u22B4', '\u20D2'}, + "nvrtrie;": {'\u22B5', '\u20D2'}, + "nvsim;": {'\u223C', '\u20D2'}, + "race;": {'\u223D', '\u0331'}, + "smtes;": {'\u2AAC', '\uFE00'}, + "sqcaps;": {'\u2293', '\uFE00'}, + "sqcups;": {'\u2294', '\uFE00'}, + "varsubsetneq;": {'\u228A', '\uFE00'}, + "varsubsetneqq;": {'\u2ACB', '\uFE00'}, + "varsupsetneq;": {'\u228B', '\uFE00'}, + "varsupsetneqq;": {'\u2ACC', '\uFE00'}, + "vnsub;": {'\u2282', '\u20D2'}, + "vnsup;": {'\u2283', '\u20D2'}, + "vsubnE;": {'\u2ACB', '\uFE00'}, + "vsubne;": {'\u228A', '\uFE00'}, + "vsupnE;": {'\u2ACC', '\uFE00'}, + "vsupne;": {'\u228B', '\uFE00'}, +} diff --git a/vendor/golang.org/x/net/html/escape.go b/vendor/golang.org/x/net/html/escape.go new file mode 100644 index 0000000..04c6bec --- /dev/null +++ b/vendor/golang.org/x/net/html/escape.go @@ -0,0 +1,339 @@ +// Copyright 2010 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package html + +import ( + "bytes" + "strings" + "unicode/utf8" +) + +// These replacements permit compatibility with old numeric entities that +// assumed Windows-1252 encoding. +// https://html.spec.whatwg.org/multipage/syntax.html#consume-a-character-reference +var replacementTable = [...]rune{ + '\u20AC', // First entry is what 0x80 should be replaced with. + '\u0081', + '\u201A', + '\u0192', + '\u201E', + '\u2026', + '\u2020', + '\u2021', + '\u02C6', + '\u2030', + '\u0160', + '\u2039', + '\u0152', + '\u008D', + '\u017D', + '\u008F', + '\u0090', + '\u2018', + '\u2019', + '\u201C', + '\u201D', + '\u2022', + '\u2013', + '\u2014', + '\u02DC', + '\u2122', + '\u0161', + '\u203A', + '\u0153', + '\u009D', + '\u017E', + '\u0178', // Last entry is 0x9F. + // 0x00->'\uFFFD' is handled programmatically. + // 0x0D->'\u000D' is a no-op. +} + +// unescapeEntity reads an entity like "<" from b[src:] and writes the +// corresponding "<" to b[dst:], returning the incremented dst and src cursors. +// Precondition: b[src] == '&' && dst <= src. +// attribute should be true if parsing an attribute value. +func unescapeEntity(b []byte, dst, src int, attribute bool) (dst1, src1 int) { + // https://html.spec.whatwg.org/multipage/syntax.html#consume-a-character-reference + + // i starts at 1 because we already know that s[0] == '&'. + i, s := 1, b[src:] + + if len(s) <= 1 { + b[dst] = b[src] + return dst + 1, src + 1 + } + + if s[i] == '#' { + if len(s) <= 3 { // We need to have at least "&#.". + b[dst] = b[src] + return dst + 1, src + 1 + } + i++ + c := s[i] + hex := false + if c == 'x' || c == 'X' { + hex = true + i++ + } + + x := '\x00' + for i < len(s) { + c = s[i] + i++ + if hex { + if '0' <= c && c <= '9' { + x = 16*x + rune(c) - '0' + continue + } else if 'a' <= c && c <= 'f' { + x = 16*x + rune(c) - 'a' + 10 + continue + } else if 'A' <= c && c <= 'F' { + x = 16*x + rune(c) - 'A' + 10 + continue + } + } else if '0' <= c && c <= '9' { + x = 10*x + rune(c) - '0' + continue + } + if c != ';' { + i-- + } + break + } + + if i <= 3 { // No characters matched. + b[dst] = b[src] + return dst + 1, src + 1 + } + + if 0x80 <= x && x <= 0x9F { + // Replace characters from Windows-1252 with UTF-8 equivalents. + x = replacementTable[x-0x80] + } else if x == 0 || (0xD800 <= x && x <= 0xDFFF) || x > 0x10FFFF { + // Replace invalid characters with the replacement character. + x = '\uFFFD' + } + + return dst + utf8.EncodeRune(b[dst:], x), src + i + } + + // Consume the maximum number of characters possible, with the + // consumed characters matching one of the named references. + + for i < len(s) { + c := s[i] + i++ + // Lower-cased characters are more common in entities, so we check for them first. + if 'a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9' { + continue + } + if c != ';' { + i-- + } + break + } + + entityName := string(s[1:i]) + if entityName == "" { + // No-op. + } else if attribute && entityName[len(entityName)-1] != ';' && len(s) > i && s[i] == '=' { + // No-op. + } else if x := entity[entityName]; x != 0 { + return dst + utf8.EncodeRune(b[dst:], x), src + i + } else if x := entity2[entityName]; x[0] != 0 { + dst1 := dst + utf8.EncodeRune(b[dst:], x[0]) + return dst1 + utf8.EncodeRune(b[dst1:], x[1]), src + i + } else if !attribute { + maxLen := len(entityName) - 1 + if maxLen > longestEntityWithoutSemicolon { + maxLen = longestEntityWithoutSemicolon + } + for j := maxLen; j > 1; j-- { + if x := entity[entityName[:j]]; x != 0 { + return dst + utf8.EncodeRune(b[dst:], x), src + j + 1 + } + } + } + + dst1, src1 = dst+i, src+i + copy(b[dst:dst1], b[src:src1]) + return dst1, src1 +} + +// unescape unescapes b's entities in-place, so that "a<b" becomes "a' byte that, per above, we'd like to avoid escaping unless we have to. +// +// Studying the summary table (and T actions in its '>' column) closely, we +// only need to escape in states 43, 44, 49, 51 and 52. State 43 is at the +// start of the comment data. State 52 is after a '!'. The other three states +// are after a '-'. +// +// Our algorithm is thus to escape every '&' and to escape '>' if and only if: +// - The '>' is after a '!' or '-' (in the unescaped data) or +// - The '>' is at the start of the comment data (after the opening ""); err != nil { + return err + } + return nil + case DoctypeNode: + if _, err := w.WriteString("') + case RawNode: + _, err := w.WriteString(n.Data) + return err + default: + return errors.New("html: unknown node type") + } + + // Render the opening tag. + if err := w.WriteByte('<'); err != nil { + return err + } + if _, err := w.WriteString(n.Data); err != nil { + return err + } + for _, a := range n.Attr { + if err := w.WriteByte(' '); err != nil { + return err + } + if a.Namespace != "" { + if _, err := w.WriteString(a.Namespace); err != nil { + return err + } + if err := w.WriteByte(':'); err != nil { + return err + } + } + if _, err := w.WriteString(a.Key); err != nil { + return err + } + if _, err := w.WriteString(`="`); err != nil { + return err + } + if err := escape(w, a.Val); err != nil { + return err + } + if err := w.WriteByte('"'); err != nil { + return err + } + } + if voidElements[n.Data] { + if n.FirstChild != nil { + return fmt.Errorf("html: void element <%s> has child nodes", n.Data) + } + _, err := w.WriteString("/>") + return err + } + if err := w.WriteByte('>'); err != nil { + return err + } + + // Add initial newline where there is danger of a newline beging ignored. + if c := n.FirstChild; c != nil && c.Type == TextNode && strings.HasPrefix(c.Data, "\n") { + switch n.Data { + case "pre", "listing", "textarea": + if err := w.WriteByte('\n'); err != nil { + return err + } + } + } + + // Render any child nodes + if childTextNodesAreLiteral(n) { + for c := n.FirstChild; c != nil; c = c.NextSibling { + if c.Type == TextNode { + if _, err := w.WriteString(c.Data); err != nil { + return err + } + } else { + if err := render1(w, c); err != nil { + return err + } + } + } + if n.Data == "plaintext" { + // Don't render anything else. must be the + // last element in the file, with no closing tag. + return plaintextAbort + } + } else { + for c := n.FirstChild; c != nil; c = c.NextSibling { + if err := render1(w, c); err != nil { + return err + } + } + } + + // Render the </xxx> closing tag. + if _, err := w.WriteString("</"); err != nil { + return err + } + if _, err := w.WriteString(n.Data); err != nil { + return err + } + return w.WriteByte('>') +} + +func childTextNodesAreLiteral(n *Node) bool { + // Per WHATWG HTML 13.3, if the parent of the current node is a style, + // script, xmp, iframe, noembed, noframes, or plaintext element, and the + // current node is a text node, append the value of the node's data + // literally. The specification is not explicit about it, but we only + // enforce this if we are in the HTML namespace (i.e. when the namespace is + // ""). + // NOTE: we also always include noscript elements, although the + // specification states that they should only be rendered as such if + // scripting is enabled for the node (which is not something we track). + if n.Namespace != "" { + return false + } + switch n.Data { + case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + return true + default: + return false + } +} + +// writeQuoted writes s to w surrounded by quotes. Normally it will use double +// quotes, but if s contains a double quote, it will use single quotes. +// It is used for writing the identifiers in a doctype declaration. +// In valid HTML, they can't contain both types of quotes. +func writeQuoted(w writer, s string) error { + var q byte = '"' + if strings.Contains(s, `"`) { + q = '\'' + } + if err := w.WriteByte(q); err != nil { + return err + } + if _, err := w.WriteString(s); err != nil { + return err + } + if err := w.WriteByte(q); err != nil { + return err + } + return nil +} + +// Section 12.1.2, "Elements", gives this list of void elements. Void elements +// are those that can't have any contents. +var voidElements = map[string]bool{ + "area": true, + "base": true, + "br": true, + "col": true, + "embed": true, + "hr": true, + "img": true, + "input": true, + "keygen": true, // "keygen" has been removed from the spec, but are kept here for backwards compatibility. + "link": true, + "meta": true, + "param": true, + "source": true, + "track": true, + "wbr": true, +} diff --git a/vendor/golang.org/x/net/html/token.go b/vendor/golang.org/x/net/html/token.go new file mode 100644 index 0000000..3c57880 --- /dev/null +++ b/vendor/golang.org/x/net/html/token.go @@ -0,0 +1,1272 @@ +// Copyright 2010 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package html + +import ( + "bytes" + "errors" + "io" + "strconv" + "strings" + + "golang.org/x/net/html/atom" +) + +// A TokenType is the type of a Token. +type TokenType uint32 + +const ( + // ErrorToken means that an error occurred during tokenization. + ErrorToken TokenType = iota + // TextToken means a text node. + TextToken + // A StartTagToken looks like <a>. + StartTagToken + // An EndTagToken looks like </a>. + EndTagToken + // A SelfClosingTagToken tag looks like <br/>. + SelfClosingTagToken + // A CommentToken looks like <!--x-->. + CommentToken + // A DoctypeToken looks like <!DOCTYPE x> + DoctypeToken +) + +// ErrBufferExceeded means that the buffering limit was exceeded. +var ErrBufferExceeded = errors.New("max buffer exceeded") + +// String returns a string representation of the TokenType. +func (t TokenType) String() string { + switch t { + case ErrorToken: + return "Error" + case TextToken: + return "Text" + case StartTagToken: + return "StartTag" + case EndTagToken: + return "EndTag" + case SelfClosingTagToken: + return "SelfClosingTag" + case CommentToken: + return "Comment" + case DoctypeToken: + return "Doctype" + } + return "Invalid(" + strconv.Itoa(int(t)) + ")" +} + +// An Attribute is an attribute namespace-key-value triple. Namespace is +// non-empty for foreign attributes like xlink, Key is alphabetic (and hence +// does not contain escapable characters like '&', '<' or '>'), and Val is +// unescaped (it looks like "a<b" rather than "a&lt;b"). +// +// Namespace is only used by the parser, not the tokenizer. +type Attribute struct { + Namespace, Key, Val string +} + +// A Token consists of a TokenType and some Data (tag name for start and end +// tags, content for text, comments and doctypes). A tag Token may also contain +// a slice of Attributes. Data is unescaped for all Tokens (it looks like "a<b" +// rather than "a&lt;b"). For tag Tokens, DataAtom is the atom for Data, or +// zero if Data is not a known tag name. +type Token struct { + Type TokenType + DataAtom atom.Atom + Data string + Attr []Attribute +} + +// tagString returns a string representation of a tag Token's Data and Attr. +func (t Token) tagString() string { + if len(t.Attr) == 0 { + return t.Data + } + buf := bytes.NewBufferString(t.Data) + for _, a := range t.Attr { + buf.WriteByte(' ') + buf.WriteString(a.Key) + buf.WriteString(`="`) + escape(buf, a.Val) + buf.WriteByte('"') + } + return buf.String() +} + +// String returns a string representation of the Token. +func (t Token) String() string { + switch t.Type { + case ErrorToken: + return "" + case TextToken: + return EscapeString(t.Data) + case StartTagToken: + return "<" + t.tagString() + ">" + case EndTagToken: + return "</" + t.tagString() + ">" + case SelfClosingTagToken: + return "<" + t.tagString() + "/>" + case CommentToken: + return "<!--" + escapeCommentString(t.Data) + "-->" + case DoctypeToken: + return "<!DOCTYPE " + EscapeString(t.Data) + ">" + } + return "Invalid(" + strconv.Itoa(int(t.Type)) + ")" +} + +// span is a range of bytes in a Tokenizer's buffer. The start is inclusive, +// the end is exclusive. +type span struct { + start, end int +} + +// A Tokenizer returns a stream of HTML Tokens. +type Tokenizer struct { + // r is the source of the HTML text. + r io.Reader + // tt is the TokenType of the current token. + tt TokenType + // err is the first error encountered during tokenization. It is possible + // for tt != Error && err != nil to hold: this means that Next returned a + // valid token but the subsequent Next call will return an error token. + // For example, if the HTML text input was just "plain", then the first + // Next call would set z.err to io.EOF but return a TextToken, and all + // subsequent Next calls would return an ErrorToken. + // err is never reset. Once it becomes non-nil, it stays non-nil. + err error + // readErr is the error returned by the io.Reader r. It is separate from + // err because it is valid for an io.Reader to return (n int, err1 error) + // such that n > 0 && err1 != nil, and callers should always process the + // n > 0 bytes before considering the error err1. + readErr error + // buf[raw.start:raw.end] holds the raw bytes of the current token. + // buf[raw.end:] is buffered input that will yield future tokens. + raw span + buf []byte + // maxBuf limits the data buffered in buf. A value of 0 means unlimited. + maxBuf int + // buf[data.start:data.end] holds the raw bytes of the current token's data: + // a text token's text, a tag token's tag name, etc. + data span + // pendingAttr is the attribute key and value currently being tokenized. + // When complete, pendingAttr is pushed onto attr. nAttrReturned is + // incremented on each call to TagAttr. + pendingAttr [2]span + attr [][2]span + nAttrReturned int + // rawTag is the "script" in "</script>" that closes the next token. If + // non-empty, the subsequent call to Next will return a raw or RCDATA text + // token: one that treats "<p>" as text instead of an element. + // rawTag's contents are lower-cased. + rawTag string + // textIsRaw is whether the current text token's data is not escaped. + textIsRaw bool + // convertNUL is whether NUL bytes in the current token's data should + // be converted into \ufffd replacement characters. + convertNUL bool + // allowCDATA is whether CDATA sections are allowed in the current context. + allowCDATA bool +} + +// AllowCDATA sets whether or not the tokenizer recognizes <![CDATA[foo]]> as +// the text "foo". The default value is false, which means to recognize it as +// a bogus comment "<!-- [CDATA[foo]] -->" instead. +// +// Strictly speaking, an HTML5 compliant tokenizer should allow CDATA if and +// only if tokenizing foreign content, such as MathML and SVG. However, +// tracking foreign-contentness is difficult to do purely in the tokenizer, +// as opposed to the parser, due to HTML integration points: an <svg> element +// can contain a <foreignObject> that is foreign-to-SVG but not foreign-to- +// HTML. For strict compliance with the HTML5 tokenization algorithm, it is the +// responsibility of the user of a tokenizer to call AllowCDATA as appropriate. +// In practice, if using the tokenizer without caring whether MathML or SVG +// CDATA is text or comments, such as tokenizing HTML to find all the anchor +// text, it is acceptable to ignore this responsibility. +func (z *Tokenizer) AllowCDATA(allowCDATA bool) { + z.allowCDATA = allowCDATA +} + +// NextIsNotRawText instructs the tokenizer that the next token should not be +// considered as 'raw text'. Some elements, such as script and title elements, +// normally require the next token after the opening tag to be 'raw text' that +// has no child elements. For example, tokenizing "<title>a<b>c</b>d</title>" +// yields a start tag token for "<title>", a text token for "a<b>c</b>d", and +// an end tag token for "</title>". There are no distinct start tag or end tag +// tokens for the "<b>" and "</b>". +// +// This tokenizer implementation will generally look for raw text at the right +// times. Strictly speaking, an HTML5 compliant tokenizer should not look for +// raw text if in foreign content: <title> generally needs raw text, but a +// <title> inside an <svg> does not. Another example is that a <textarea> +// generally needs raw text, but a <textarea> is not allowed as an immediate +// child of a <select>; in normal parsing, a <textarea> implies </select>, but +// one cannot close the implicit element when parsing a <select>'s InnerHTML. +// Similarly to AllowCDATA, tracking the correct moment to override raw-text- +// ness is difficult to do purely in the tokenizer, as opposed to the parser. +// For strict compliance with the HTML5 tokenization algorithm, it is the +// responsibility of the user of a tokenizer to call NextIsNotRawText as +// appropriate. In practice, like AllowCDATA, it is acceptable to ignore this +// responsibility for basic usage. +// +// Note that this 'raw text' concept is different from the one offered by the +// Tokenizer.Raw method. +func (z *Tokenizer) NextIsNotRawText() { + z.rawTag = "" +} + +// Err returns the error associated with the most recent ErrorToken token. +// This is typically io.EOF, meaning the end of tokenization. +func (z *Tokenizer) Err() error { + if z.tt != ErrorToken { + return nil + } + return z.err +} + +// readByte returns the next byte from the input stream, doing a buffered read +// from z.r into z.buf if necessary. z.buf[z.raw.start:z.raw.end] remains a contiguous byte +// slice that holds all the bytes read so far for the current token. +// It sets z.err if the underlying reader returns an error. +// Pre-condition: z.err == nil. +func (z *Tokenizer) readByte() byte { + if z.raw.end >= len(z.buf) { + // Our buffer is exhausted and we have to read from z.r. Check if the + // previous read resulted in an error. + if z.readErr != nil { + z.err = z.readErr + return 0 + } + // We copy z.buf[z.raw.start:z.raw.end] to the beginning of z.buf. If the length + // z.raw.end - z.raw.start is more than half the capacity of z.buf, then we + // allocate a new buffer before the copy. + c := cap(z.buf) + d := z.raw.end - z.raw.start + var buf1 []byte + if 2*d > c { + buf1 = make([]byte, d, 2*c) + } else { + buf1 = z.buf[:d] + } + copy(buf1, z.buf[z.raw.start:z.raw.end]) + if x := z.raw.start; x != 0 { + // Adjust the data/attr spans to refer to the same contents after the copy. + z.data.start -= x + z.data.end -= x + z.pendingAttr[0].start -= x + z.pendingAttr[0].end -= x + z.pendingAttr[1].start -= x + z.pendingAttr[1].end -= x + for i := range z.attr { + z.attr[i][0].start -= x + z.attr[i][0].end -= x + z.attr[i][1].start -= x + z.attr[i][1].end -= x + } + } + z.raw.start, z.raw.end, z.buf = 0, d, buf1[:d] + // Now that we have copied the live bytes to the start of the buffer, + // we read from z.r into the remainder. + var n int + n, z.readErr = readAtLeastOneByte(z.r, buf1[d:cap(buf1)]) + if n == 0 { + z.err = z.readErr + return 0 + } + z.buf = buf1[:d+n] + } + x := z.buf[z.raw.end] + z.raw.end++ + if z.maxBuf > 0 && z.raw.end-z.raw.start >= z.maxBuf { + z.err = ErrBufferExceeded + return 0 + } + return x +} + +// Buffered returns a slice containing data buffered but not yet tokenized. +func (z *Tokenizer) Buffered() []byte { + return z.buf[z.raw.end:] +} + +// readAtLeastOneByte wraps an io.Reader so that reading cannot return (0, nil). +// It returns io.ErrNoProgress if the underlying r.Read method returns (0, nil) +// too many times in succession. +func readAtLeastOneByte(r io.Reader, b []byte) (int, error) { + for i := 0; i < 100; i++ { + if n, err := r.Read(b); n != 0 || err != nil { + return n, err + } + } + return 0, io.ErrNoProgress +} + +// skipWhiteSpace skips past any white space. +func (z *Tokenizer) skipWhiteSpace() { + if z.err != nil { + return + } + for { + c := z.readByte() + if z.err != nil { + return + } + switch c { + case ' ', '\n', '\r', '\t', '\f': + // No-op. + default: + z.raw.end-- + return + } + } +} + +// readRawOrRCDATA reads until the next "</foo>", where "foo" is z.rawTag and +// is typically something like "script" or "textarea". +func (z *Tokenizer) readRawOrRCDATA() { + if z.rawTag == "script" { + z.readScript() + z.textIsRaw = true + z.rawTag = "" + return + } +loop: + for { + c := z.readByte() + if z.err != nil { + break loop + } + if c != '<' { + continue loop + } + c = z.readByte() + if z.err != nil { + break loop + } + if c != '/' { + z.raw.end-- + continue loop + } + if z.readRawEndTag() || z.err != nil { + break loop + } + } + z.data.end = z.raw.end + // A textarea's or title's RCDATA can contain escaped entities. + z.textIsRaw = z.rawTag != "textarea" && z.rawTag != "title" + z.rawTag = "" +} + +// readRawEndTag attempts to read a tag like "</foo>", where "foo" is z.rawTag. +// If it succeeds, it backs up the input position to reconsume the tag and +// returns true. Otherwise it returns false. The opening "</" has already been +// consumed. +func (z *Tokenizer) readRawEndTag() bool { + for i := 0; i < len(z.rawTag); i++ { + c := z.readByte() + if z.err != nil { + return false + } + if c != z.rawTag[i] && c != z.rawTag[i]-('a'-'A') { + z.raw.end-- + return false + } + } + c := z.readByte() + if z.err != nil { + return false + } + switch c { + case ' ', '\n', '\r', '\t', '\f', '/', '>': + // The 3 is 2 for the leading "</" plus 1 for the trailing character c. + z.raw.end -= 3 + len(z.rawTag) + return true + } + z.raw.end-- + return false +} + +// readScript reads until the next </script> tag, following the byzantine +// rules for escaping/hiding the closing tag. +func (z *Tokenizer) readScript() { + defer func() { + z.data.end = z.raw.end + }() + var c byte + +scriptData: + c = z.readByte() + if z.err != nil { + return + } + if c == '<' { + goto scriptDataLessThanSign + } + goto scriptData + +scriptDataLessThanSign: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '/': + goto scriptDataEndTagOpen + case '!': + goto scriptDataEscapeStart + } + z.raw.end-- + goto scriptData + +scriptDataEndTagOpen: + if z.readRawEndTag() || z.err != nil { + return + } + goto scriptData + +scriptDataEscapeStart: + c = z.readByte() + if z.err != nil { + return + } + if c == '-' { + goto scriptDataEscapeStartDash + } + z.raw.end-- + goto scriptData + +scriptDataEscapeStartDash: + c = z.readByte() + if z.err != nil { + return + } + if c == '-' { + goto scriptDataEscapedDashDash + } + z.raw.end-- + goto scriptData + +scriptDataEscaped: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '-': + goto scriptDataEscapedDash + case '<': + goto scriptDataEscapedLessThanSign + } + goto scriptDataEscaped + +scriptDataEscapedDash: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '-': + goto scriptDataEscapedDashDash + case '<': + goto scriptDataEscapedLessThanSign + } + goto scriptDataEscaped + +scriptDataEscapedDashDash: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '-': + goto scriptDataEscapedDashDash + case '<': + goto scriptDataEscapedLessThanSign + case '>': + goto scriptData + } + goto scriptDataEscaped + +scriptDataEscapedLessThanSign: + c = z.readByte() + if z.err != nil { + return + } + if c == '/' { + goto scriptDataEscapedEndTagOpen + } + if 'a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' { + goto scriptDataDoubleEscapeStart + } + z.raw.end-- + goto scriptData + +scriptDataEscapedEndTagOpen: + if z.readRawEndTag() || z.err != nil { + return + } + goto scriptDataEscaped + +scriptDataDoubleEscapeStart: + z.raw.end-- + for i := 0; i < len("script"); i++ { + c = z.readByte() + if z.err != nil { + return + } + if c != "script"[i] && c != "SCRIPT"[i] { + z.raw.end-- + goto scriptDataEscaped + } + } + c = z.readByte() + if z.err != nil { + return + } + switch c { + case ' ', '\n', '\r', '\t', '\f', '/', '>': + goto scriptDataDoubleEscaped + } + z.raw.end-- + goto scriptDataEscaped + +scriptDataDoubleEscaped: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '-': + goto scriptDataDoubleEscapedDash + case '<': + goto scriptDataDoubleEscapedLessThanSign + } + goto scriptDataDoubleEscaped + +scriptDataDoubleEscapedDash: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '-': + goto scriptDataDoubleEscapedDashDash + case '<': + goto scriptDataDoubleEscapedLessThanSign + } + goto scriptDataDoubleEscaped + +scriptDataDoubleEscapedDashDash: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '-': + goto scriptDataDoubleEscapedDashDash + case '<': + goto scriptDataDoubleEscapedLessThanSign + case '>': + goto scriptData + } + goto scriptDataDoubleEscaped + +scriptDataDoubleEscapedLessThanSign: + c = z.readByte() + if z.err != nil { + return + } + if c == '/' { + goto scriptDataDoubleEscapeEnd + } + z.raw.end-- + goto scriptDataDoubleEscaped + +scriptDataDoubleEscapeEnd: + if z.readRawEndTag() { + z.raw.end += len("</script>") + goto scriptDataEscaped + } + if z.err != nil { + return + } + goto scriptDataDoubleEscaped +} + +// readComment reads the next comment token starting with "<!--". The opening +// "<!--" has already been consumed. +func (z *Tokenizer) readComment() { + // When modifying this function, consider manually increasing the + // maxSuffixLen constant in func TestComments, from 6 to e.g. 9 or more. + // That increase should only be temporary, not committed, as it + // exponentially affects the test running time. + + z.data.start = z.raw.end + defer func() { + if z.data.end < z.data.start { + // It's a comment with no data, like <!-->. + z.data.end = z.data.start + } + }() + + var dashCount int + beginning := true + for { + c := z.readByte() + if z.err != nil { + z.data.end = z.calculateAbruptCommentDataEnd() + return + } + switch c { + case '-': + dashCount++ + continue + case '>': + if dashCount >= 2 || beginning { + z.data.end = z.raw.end - len("-->") + return + } + case '!': + if dashCount >= 2 { + c = z.readByte() + if z.err != nil { + z.data.end = z.calculateAbruptCommentDataEnd() + return + } else if c == '>' { + z.data.end = z.raw.end - len("--!>") + return + } else if c == '-' { + dashCount = 1 + beginning = false + continue + } + } + } + dashCount = 0 + beginning = false + } +} + +func (z *Tokenizer) calculateAbruptCommentDataEnd() int { + raw := z.Raw() + const prefixLen = len("<!--") + if len(raw) >= prefixLen { + raw = raw[prefixLen:] + if hasSuffix(raw, "--!") { + return z.raw.end - 3 + } else if hasSuffix(raw, "--") { + return z.raw.end - 2 + } else if hasSuffix(raw, "-") { + return z.raw.end - 1 + } + } + return z.raw.end +} + +func hasSuffix(b []byte, suffix string) bool { + if len(b) < len(suffix) { + return false + } + b = b[len(b)-len(suffix):] + for i := range b { + if b[i] != suffix[i] { + return false + } + } + return true +} + +// readUntilCloseAngle reads until the next ">". +func (z *Tokenizer) readUntilCloseAngle() { + z.data.start = z.raw.end + for { + c := z.readByte() + if z.err != nil { + z.data.end = z.raw.end + return + } + if c == '>' { + z.data.end = z.raw.end - len(">") + return + } + } +} + +// readMarkupDeclaration reads the next token starting with "<!". It might be +// a "<!--comment-->", a "<!DOCTYPE foo>", a "<![CDATA[section]]>" or +// "<!a bogus comment". The opening "<!" has already been consumed. +func (z *Tokenizer) readMarkupDeclaration() TokenType { + z.data.start = z.raw.end + var c [2]byte + for i := 0; i < 2; i++ { + c[i] = z.readByte() + if z.err != nil { + z.data.end = z.raw.end + return CommentToken + } + } + if c[0] == '-' && c[1] == '-' { + z.readComment() + return CommentToken + } + z.raw.end -= 2 + if z.readDoctype() { + return DoctypeToken + } + if z.allowCDATA && z.readCDATA() { + z.convertNUL = true + return TextToken + } + // It's a bogus comment. + z.readUntilCloseAngle() + return CommentToken +} + +// readDoctype attempts to read a doctype declaration and returns true if +// successful. The opening "<!" has already been consumed. +func (z *Tokenizer) readDoctype() bool { + const s = "DOCTYPE" + for i := 0; i < len(s); i++ { + c := z.readByte() + if z.err != nil { + z.data.end = z.raw.end + return false + } + if c != s[i] && c != s[i]+('a'-'A') { + // Back up to read the fragment of "DOCTYPE" again. + z.raw.end = z.data.start + return false + } + } + if z.skipWhiteSpace(); z.err != nil { + z.data.start = z.raw.end + z.data.end = z.raw.end + return true + } + z.readUntilCloseAngle() + return true +} + +// readCDATA attempts to read a CDATA section and returns true if +// successful. The opening "<!" has already been consumed. +func (z *Tokenizer) readCDATA() bool { + const s = "[CDATA[" + for i := 0; i < len(s); i++ { + c := z.readByte() + if z.err != nil { + z.data.end = z.raw.end + return false + } + if c != s[i] { + // Back up to read the fragment of "[CDATA[" again. + z.raw.end = z.data.start + return false + } + } + z.data.start = z.raw.end + brackets := 0 + for { + c := z.readByte() + if z.err != nil { + z.data.end = z.raw.end + return true + } + switch c { + case ']': + brackets++ + case '>': + if brackets >= 2 { + z.data.end = z.raw.end - len("]]>") + return true + } + brackets = 0 + default: + brackets = 0 + } + } +} + +// startTagIn returns whether the start tag in z.buf[z.data.start:z.data.end] +// case-insensitively matches any element of ss. +func (z *Tokenizer) startTagIn(ss ...string) bool { +loop: + for _, s := range ss { + if z.data.end-z.data.start != len(s) { + continue loop + } + for i := 0; i < len(s); i++ { + c := z.buf[z.data.start+i] + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } + if c != s[i] { + continue loop + } + } + return true + } + return false +} + +// readStartTag reads the next start tag token. The opening "<a" has already +// been consumed, where 'a' means anything in [A-Za-z]. +func (z *Tokenizer) readStartTag() TokenType { + z.readTag(true) + if z.err != nil { + return ErrorToken + } + // Several tags flag the tokenizer's next token as raw. + c, raw := z.buf[z.data.start], false + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } + switch c { + case 'i': + raw = z.startTagIn("iframe") + case 'n': + raw = z.startTagIn("noembed", "noframes", "noscript") + case 'p': + raw = z.startTagIn("plaintext") + case 's': + raw = z.startTagIn("script", "style") + case 't': + raw = z.startTagIn("textarea", "title") + case 'x': + raw = z.startTagIn("xmp") + } + if raw { + z.rawTag = strings.ToLower(string(z.buf[z.data.start:z.data.end])) + } + // Look for a self-closing token like "<br/>". + if z.err == nil && z.buf[z.raw.end-2] == '/' { + return SelfClosingTagToken + } + return StartTagToken +} + +// readTag reads the next tag token and its attributes. If saveAttr, those +// attributes are saved in z.attr, otherwise z.attr is set to an empty slice. +// The opening "<a" or "</a" has already been consumed, where 'a' means anything +// in [A-Za-z]. +func (z *Tokenizer) readTag(saveAttr bool) { + z.attr = z.attr[:0] + z.nAttrReturned = 0 + // Read the tag name and attribute key/value pairs. + z.readTagName() + if z.skipWhiteSpace(); z.err != nil { + return + } + for { + c := z.readByte() + if z.err != nil || c == '>' { + break + } + z.raw.end-- + z.readTagAttrKey() + z.readTagAttrVal() + // Save pendingAttr if saveAttr and that attribute has a non-empty key. + if saveAttr && z.pendingAttr[0].start != z.pendingAttr[0].end { + z.attr = append(z.attr, z.pendingAttr) + } + if z.skipWhiteSpace(); z.err != nil { + break + } + } +} + +// readTagName sets z.data to the "div" in "<div k=v>". The reader (z.raw.end) +// is positioned such that the first byte of the tag name (the "d" in "<div") +// has already been consumed. +func (z *Tokenizer) readTagName() { + z.data.start = z.raw.end - 1 + for { + c := z.readByte() + if z.err != nil { + z.data.end = z.raw.end + return + } + switch c { + case ' ', '\n', '\r', '\t', '\f': + z.data.end = z.raw.end - 1 + return + case '/', '>': + z.raw.end-- + z.data.end = z.raw.end + return + } + } +} + +// readTagAttrKey sets z.pendingAttr[0] to the "k" in "<div k=v>". +// Precondition: z.err == nil. +func (z *Tokenizer) readTagAttrKey() { + z.pendingAttr[0].start = z.raw.end + for { + c := z.readByte() + if z.err != nil { + z.pendingAttr[0].end = z.raw.end + return + } + switch c { + case '=': + if z.pendingAttr[0].start+1 == z.raw.end { + // WHATWG 13.2.5.32, if we see an equals sign before the attribute name + // begins, we treat it as a character in the attribute name and continue. + continue + } + fallthrough + case ' ', '\n', '\r', '\t', '\f', '/', '>': + // WHATWG 13.2.5.33 Attribute name state + // We need to reconsume the char in the after attribute name state to support the / character + z.raw.end-- + z.pendingAttr[0].end = z.raw.end + return + } + } +} + +// readTagAttrVal sets z.pendingAttr[1] to the "v" in "<div k=v>". +func (z *Tokenizer) readTagAttrVal() { + z.pendingAttr[1].start = z.raw.end + z.pendingAttr[1].end = z.raw.end + if z.skipWhiteSpace(); z.err != nil { + return + } + c := z.readByte() + if z.err != nil { + return + } + if c == '/' { + // WHATWG 13.2.5.34 After attribute name state + // U+002F SOLIDUS (/) - Switch to the self-closing start tag state. + return + } + if c != '=' { + z.raw.end-- + return + } + if z.skipWhiteSpace(); z.err != nil { + return + } + quote := z.readByte() + if z.err != nil { + return + } + switch quote { + case '>': + z.raw.end-- + return + + case '\'', '"': + z.pendingAttr[1].start = z.raw.end + for { + c := z.readByte() + if z.err != nil { + z.pendingAttr[1].end = z.raw.end + return + } + if c == quote { + z.pendingAttr[1].end = z.raw.end - 1 + return + } + } + + default: + z.pendingAttr[1].start = z.raw.end - 1 + for { + c := z.readByte() + if z.err != nil { + z.pendingAttr[1].end = z.raw.end + return + } + switch c { + case ' ', '\n', '\r', '\t', '\f': + z.pendingAttr[1].end = z.raw.end - 1 + return + case '>': + z.raw.end-- + z.pendingAttr[1].end = z.raw.end + return + } + } + } +} + +// Next scans the next token and returns its type. +func (z *Tokenizer) Next() TokenType { + z.raw.start = z.raw.end + z.data.start = z.raw.end + z.data.end = z.raw.end + if z.err != nil { + z.tt = ErrorToken + return z.tt + } + if z.rawTag != "" { + if z.rawTag == "plaintext" { + // Read everything up to EOF. + for z.err == nil { + z.readByte() + } + z.data.end = z.raw.end + z.textIsRaw = true + } else { + z.readRawOrRCDATA() + } + if z.data.end > z.data.start { + z.tt = TextToken + z.convertNUL = true + return z.tt + } + } + z.textIsRaw = false + z.convertNUL = false + +loop: + for { + c := z.readByte() + if z.err != nil { + break loop + } + if c != '<' { + continue loop + } + + // Check if the '<' we have just read is part of a tag, comment + // or doctype. If not, it's part of the accumulated text token. + c = z.readByte() + if z.err != nil { + break loop + } + var tokenType TokenType + switch { + case 'a' <= c && c <= 'z' || 'A' <= c && c <= 'Z': + tokenType = StartTagToken + case c == '/': + tokenType = EndTagToken + case c == '!' || c == '?': + // We use CommentToken to mean any of "<!--actual comments-->", + // "<!DOCTYPE declarations>" and "<?xml processing instructions?>". + tokenType = CommentToken + default: + // Reconsume the current character. + z.raw.end-- + continue + } + + // We have a non-text token, but we might have accumulated some text + // before that. If so, we return the text first, and return the non- + // text token on the subsequent call to Next. + if x := z.raw.end - len("<a"); z.raw.start < x { + z.raw.end = x + z.data.end = x + z.tt = TextToken + return z.tt + } + switch tokenType { + case StartTagToken: + z.tt = z.readStartTag() + return z.tt + case EndTagToken: + c = z.readByte() + if z.err != nil { + break loop + } + if c == '>' { + // "</>" does not generate a token at all. Generate an empty comment + // to allow passthrough clients to pick up the data using Raw. + // Reset the tokenizer state and start again. + z.tt = CommentToken + return z.tt + } + if 'a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' { + z.readTag(false) + if z.err != nil { + z.tt = ErrorToken + } else { + z.tt = EndTagToken + } + return z.tt + } + z.raw.end-- + z.readUntilCloseAngle() + z.tt = CommentToken + return z.tt + case CommentToken: + if c == '!' { + z.tt = z.readMarkupDeclaration() + return z.tt + } + z.raw.end-- + z.readUntilCloseAngle() + z.tt = CommentToken + return z.tt + } + } + if z.raw.start < z.raw.end { + z.data.end = z.raw.end + z.tt = TextToken + return z.tt + } + z.tt = ErrorToken + return z.tt +} + +// Raw returns the unmodified text of the current token. Calling Next, Token, +// Text, TagName or TagAttr may change the contents of the returned slice. +// +// The token stream's raw bytes partition the byte stream (up until an +// ErrorToken). There are no overlaps or gaps between two consecutive token's +// raw bytes. One implication is that the byte offset of the current token is +// the sum of the lengths of all previous tokens' raw bytes. +func (z *Tokenizer) Raw() []byte { + return z.buf[z.raw.start:z.raw.end] +} + +// convertNewlines converts "\r" and "\r\n" in s to "\n". +// The conversion happens in place, but the resulting slice may be shorter. +func convertNewlines(s []byte) []byte { + for i, c := range s { + if c != '\r' { + continue + } + + src := i + 1 + if src >= len(s) || s[src] != '\n' { + s[i] = '\n' + continue + } + + dst := i + for src < len(s) { + if s[src] == '\r' { + if src+1 < len(s) && s[src+1] == '\n' { + src++ + } + s[dst] = '\n' + } else { + s[dst] = s[src] + } + src++ + dst++ + } + return s[:dst] + } + return s +} + +var ( + nul = []byte("\x00") + replacement = []byte("\ufffd") +) + +// Text returns the unescaped text of a text, comment or doctype token. The +// contents of the returned slice may change on the next call to Next. +func (z *Tokenizer) Text() []byte { + switch z.tt { + case TextToken, CommentToken, DoctypeToken: + s := z.buf[z.data.start:z.data.end] + z.data.start = z.raw.end + z.data.end = z.raw.end + s = convertNewlines(s) + if (z.convertNUL || z.tt == CommentToken) && bytes.Contains(s, nul) { + s = bytes.Replace(s, nul, replacement, -1) + } + if !z.textIsRaw { + s = unescape(s, false) + } + return s + } + return nil +} + +// TagName returns the lower-cased name of a tag token (the `img` out of +// `<IMG SRC="foo">`) and whether the tag has attributes. +// The contents of the returned slice may change on the next call to Next. +func (z *Tokenizer) TagName() (name []byte, hasAttr bool) { + if z.data.start < z.data.end { + switch z.tt { + case StartTagToken, EndTagToken, SelfClosingTagToken: + s := z.buf[z.data.start:z.data.end] + z.data.start = z.raw.end + z.data.end = z.raw.end + return lower(s), z.nAttrReturned < len(z.attr) + } + } + return nil, false +} + +// TagAttr returns the lower-cased key and unescaped value of the next unparsed +// attribute for the current tag token and whether there are more attributes. +// The contents of the returned slices may change on the next call to Next. +func (z *Tokenizer) TagAttr() (key, val []byte, moreAttr bool) { + if z.nAttrReturned < len(z.attr) { + switch z.tt { + case StartTagToken, SelfClosingTagToken: + x := z.attr[z.nAttrReturned] + z.nAttrReturned++ + key = z.buf[x[0].start:x[0].end] + val = z.buf[x[1].start:x[1].end] + return lower(key), unescape(convertNewlines(val), true), z.nAttrReturned < len(z.attr) + } + } + return nil, nil, false +} + +// Token returns the current Token. The result's Data and Attr values remain +// valid after subsequent Next calls. +func (z *Tokenizer) Token() Token { + t := Token{Type: z.tt} + switch z.tt { + case TextToken, CommentToken, DoctypeToken: + t.Data = string(z.Text()) + case StartTagToken, SelfClosingTagToken, EndTagToken: + name, moreAttr := z.TagName() + for moreAttr { + var key, val []byte + key, val, moreAttr = z.TagAttr() + t.Attr = append(t.Attr, Attribute{"", atom.String(key), string(val)}) + } + if a := atom.Lookup(name); a != 0 { + t.DataAtom, t.Data = a, a.String() + } else { + t.DataAtom, t.Data = 0, string(name) + } + } + return t +} + +// SetMaxBuf sets a limit on the amount of data buffered during tokenization. +// A value of 0 means unlimited. +func (z *Tokenizer) SetMaxBuf(n int) { + z.maxBuf = n +} + +// NewTokenizer returns a new HTML Tokenizer for the given Reader. +// The input is assumed to be UTF-8 encoded. +func NewTokenizer(r io.Reader) *Tokenizer { + return NewTokenizerFragment(r, "") +} + +// NewTokenizerFragment returns a new HTML Tokenizer for the given Reader, for +// tokenizing an existing element's InnerHTML fragment. contextTag is that +// element's tag, such as "div" or "iframe". +// +// For example, how the InnerHTML "a<b" is tokenized depends on whether it is +// for a <p> tag or a <script> tag. +// +// The input is assumed to be UTF-8 encoded. +func NewTokenizerFragment(r io.Reader, contextTag string) *Tokenizer { + z := &Tokenizer{ + r: r, + buf: make([]byte, 0, 4096), + } + if contextTag != "" { + switch s := strings.ToLower(contextTag); s { + case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "title", "textarea", "xmp": + z.rawTag = s + } + } + return z +} diff --git a/vendor/golang.org/x/text/feature/plural/tables.go b/vendor/golang.org/x/text/feature/plural/tables.go index 59ae9f2..b06b9cb 100644 --- a/vendor/golang.org/x/text/feature/plural/tables.go +++ b/vendor/golang.org/x/text/feature/plural/tables.go @@ -549,4 +549,4 @@ var cardinalInclusionMasks = []uint64{ // 100 elements // Slots used for cardinal: A6 of 0xFF rules; 24 of 0xFF indexes; 37 of 64 sets -// Total table size 3860 bytes (3KiB); checksum: 4E56F7B1 +// Total table size 3860 bytes (3KiB); checksum: AAFBF21 diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go index 83816a7..8c1b666 100644 --- a/vendor/golang.org/x/text/internal/language/compact/language.go +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -118,7 +118,7 @@ func (t Tag) Parent() Tag { return Tag{language: lang, locale: lang} } -// returns token t and the rest of the string. +// nextToken returns token t and the rest of the string. func nextToken(s string) (t, tail string) { p := strings.Index(s[1:], "-") if p == -1 { diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go index 32af9de..a09ed19 100644 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: 6772C83C +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go index 6105bc7..09d41c7 100644 --- a/vendor/golang.org/x/text/internal/language/language.go +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -409,7 +409,7 @@ func (t Tag) SetTypeForKey(key, value string) (Tag, error) { return t, nil } -// findKeyAndType returns the start and end position for the type corresponding +// findTypeForKey returns the start and end position for the type corresponding // to key or the point at which to insert the key-value pair if the type // wasn't found. The hasExt return value reports whether an -u extension was present. // Note: the extensions are typically very small and are likely to contain diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go index fb6b583..14167e7 100644 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8752 +const NumLanguages = 8798 -const NumScripts = 258 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -263,7 +263,7 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, @@ -278,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -289,11 +289,11 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, @@ -303,20 +303,20 @@ var langNoIndex = [2197]uint8{ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -337,7 +337,7 @@ var langNoIndex = [2197]uint8{ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F @@ -359,13 +359,13 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, @@ -392,14 +392,14 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, @@ -424,12 +424,12 @@ var langNoIndex = [2197]uint8{ // Entry 480 - 4BF 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, @@ -441,7 +441,7 @@ var langNoIndex = [2197]uint8{ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -449,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -464,13 +464,13 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, @@ -491,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -513,7 +513,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, @@ -522,7 +522,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, @@ -530,12 +530,12 @@ var langNoIndex = [2197]uint8{ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF @@ -545,11 +545,11 @@ var langNoIndex = [2197]uint8{ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, @@ -557,11 +557,11 @@ var langNoIndex = [2197]uint8{ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -583,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 716 bytes, 179 elements -var AliasMap = [179]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -599,223 +599,239 @@ var AliasMap = [179]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8a8, To: 0x8b7}, - 29: {From: 0x8c3, To: 0xee3}, - 30: {From: 0x8fa, To: 0x1dc}, - 31: {From: 0x9ef, To: 0x331}, - 32: {From: 0xa36, To: 0x2c5}, - 33: {From: 0xa3d, To: 0xbf}, - 34: {From: 0xabe, To: 0x3322}, - 35: {From: 0xb38, To: 0x529}, - 36: {From: 0xb75, To: 0x265a}, - 37: {From: 0xb7e, To: 0xbc3}, - 38: {From: 0xb9b, To: 0x44e}, - 39: {From: 0xbbc, To: 0x4229}, - 40: {From: 0xbbf, To: 0x529}, - 41: {From: 0xbfe, To: 0x2da7}, - 42: {From: 0xc2e, To: 0x3181}, - 43: {From: 0xcb9, To: 0xf3}, - 44: {From: 0xd08, To: 0xfa}, - 45: {From: 0xdc8, To: 0x11a}, - 46: {From: 0xdd7, To: 0x32d}, - 47: {From: 0xdf8, To: 0xdfb}, - 48: {From: 0xdfe, To: 0x531}, - 49: {From: 0xe01, To: 0xdf3}, - 50: {From: 0xedf, To: 0x205a}, - 51: {From: 0xee9, To: 0x222e}, - 52: {From: 0xeee, To: 0x2e9a}, - 53: {From: 0xf39, To: 0x367}, - 54: {From: 0x10d0, To: 0x140}, - 55: {From: 0x1104, To: 0x2d0}, - 56: {From: 0x11a0, To: 0x1ec}, - 57: {From: 0x1279, To: 0x21}, - 58: {From: 0x1424, To: 0x15e}, - 59: {From: 0x1470, To: 0x14e}, - 60: {From: 0x151f, To: 0xd9b}, - 61: {From: 0x1523, To: 0x390}, - 62: {From: 0x1532, To: 0x19f}, - 63: {From: 0x1580, To: 0x210}, - 64: {From: 0x1583, To: 0x10d}, - 65: {From: 0x15a3, To: 0x3caf}, - 66: {From: 0x1630, To: 0x222e}, - 67: {From: 0x166a, To: 0x19b}, - 68: {From: 0x16c8, To: 0x136}, - 69: {From: 0x1700, To: 0x29f8}, - 70: {From: 0x1718, To: 0x194}, - 71: {From: 0x1727, To: 0xf3f}, - 72: {From: 0x177a, To: 0x178}, - 73: {From: 0x1809, To: 0x17b6}, - 74: {From: 0x1816, To: 0x18f3}, - 75: {From: 0x188a, To: 0x436}, - 76: {From: 0x1979, To: 0x1d01}, - 77: {From: 0x1a74, To: 0x2bb0}, - 78: {From: 0x1a8a, To: 0x1f8}, - 79: {From: 0x1b5a, To: 0x1fa}, - 80: {From: 0x1b86, To: 0x1515}, - 81: {From: 0x1d64, To: 0x2c9b}, - 82: {From: 0x2038, To: 0x37b1}, - 83: {From: 0x203d, To: 0x20dd}, - 84: {From: 0x205a, To: 0x30b}, - 85: {From: 0x20e3, To: 0x274}, - 86: {From: 0x20ee, To: 0x263}, - 87: {From: 0x20f2, To: 0x22d}, - 88: {From: 0x20f9, To: 0x256}, - 89: {From: 0x210f, To: 0x21eb}, - 90: {From: 0x2135, To: 0x27d}, - 91: {From: 0x2160, To: 0x913}, - 92: {From: 0x2199, To: 0x121}, - 93: {From: 0x21ce, To: 0x1561}, - 94: {From: 0x21e6, To: 0x504}, - 95: {From: 0x21f4, To: 0x49f}, - 96: {From: 0x21fb, To: 0x269}, - 97: {From: 0x222d, To: 0x121}, - 98: {From: 0x2237, To: 0x121}, - 99: {From: 0x2262, To: 0x92a}, - 100: {From: 0x2316, To: 0x3226}, - 101: {From: 0x236a, To: 0x2835}, - 102: {From: 0x2382, To: 0x3365}, - 103: {From: 0x2472, To: 0x2c7}, - 104: {From: 0x24e4, To: 0x2ff}, - 105: {From: 0x24f0, To: 0x2fa}, - 106: {From: 0x24fa, To: 0x31f}, - 107: {From: 0x2550, To: 0xb5b}, - 108: {From: 0x25a9, To: 0xe2}, - 109: {From: 0x263e, To: 0x2d0}, - 110: {From: 0x26c9, To: 0x26b4}, - 111: {From: 0x26f9, To: 0x3c8}, - 112: {From: 0x2727, To: 0x3caf}, - 113: {From: 0x2755, To: 0x6a4}, - 114: {From: 0x2765, To: 0x26b4}, - 115: {From: 0x2789, To: 0x4358}, - 116: {From: 0x27c9, To: 0x2001}, - 117: {From: 0x28ea, To: 0x27b1}, - 118: {From: 0x28ef, To: 0x2837}, - 119: {From: 0x2914, To: 0x351}, - 120: {From: 0x2986, To: 0x2da7}, - 121: {From: 0x29f0, To: 0x96b}, - 122: {From: 0x2b1a, To: 0x38d}, - 123: {From: 0x2bfc, To: 0x395}, - 124: {From: 0x2c3f, To: 0x3caf}, - 125: {From: 0x2ce1, To: 0x2201}, - 126: {From: 0x2cfc, To: 0x3be}, - 127: {From: 0x2d13, To: 0x597}, - 128: {From: 0x2d47, To: 0x148}, - 129: {From: 0x2d48, To: 0x148}, - 130: {From: 0x2dff, To: 0x2f1}, - 131: {From: 0x2e08, To: 0x19cc}, - 132: {From: 0x2e1a, To: 0x2d95}, - 133: {From: 0x2e21, To: 0x292}, - 134: {From: 0x2e54, To: 0x7d}, - 135: {From: 0x2e65, To: 0x2282}, - 136: {From: 0x2ea0, To: 0x2e9b}, - 137: {From: 0x2eef, To: 0x2ed7}, - 138: {From: 0x3193, To: 0x3c4}, - 139: {From: 0x3366, To: 0x338e}, - 140: {From: 0x342a, To: 0x3dc}, - 141: {From: 0x34ee, To: 0x18d0}, - 142: {From: 0x35c8, To: 0x2c9b}, - 143: {From: 0x35e6, To: 0x412}, - 144: {From: 0x3658, To: 0x246}, - 145: {From: 0x3676, To: 0x3f4}, - 146: {From: 0x36fd, To: 0x445}, - 147: {From: 0x37c0, To: 0x121}, - 148: {From: 0x3816, To: 0x38f2}, - 149: {From: 0x382a, To: 0x2b48}, - 150: {From: 0x382b, To: 0x2c9b}, - 151: {From: 0x382f, To: 0xa9}, - 152: {From: 0x3832, To: 0x3228}, - 153: {From: 0x386c, To: 0x39a6}, - 154: {From: 0x3892, To: 0x3fc0}, - 155: {From: 0x38a5, To: 0x39d7}, - 156: {From: 0x38b4, To: 0x1fa4}, - 157: {From: 0x38b5, To: 0x2e9a}, - 158: {From: 0x395c, To: 0x47e}, - 159: {From: 0x3b4e, To: 0xd91}, - 160: {From: 0x3b78, To: 0x137}, - 161: {From: 0x3c99, To: 0x4bc}, - 162: {From: 0x3fbd, To: 0x100}, - 163: {From: 0x4208, To: 0xa91}, - 164: {From: 0x42be, To: 0x573}, - 165: {From: 0x42f9, To: 0x3f60}, - 166: {From: 0x4378, To: 0x25a}, - 167: {From: 0x43b8, To: 0xe6c}, - 168: {From: 0x43cd, To: 0x10f}, - 169: {From: 0x44af, To: 0x3322}, - 170: {From: 0x44e3, To: 0x512}, - 171: {From: 0x45ca, To: 0x2409}, - 172: {From: 0x45dd, To: 0x26dc}, - 173: {From: 0x4610, To: 0x48ae}, - 174: {From: 0x46ae, To: 0x46a0}, - 175: {From: 0x473e, To: 0x4745}, - 176: {From: 0x4817, To: 0x3503}, - 177: {From: 0x4916, To: 0x31f}, - 178: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 179 bytes, 179 elements -var AliasTypes = [179]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, - 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, - 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, - 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, - 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, - 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, - 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, - 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1040 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + - "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + - "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + - "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + - "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + - "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + - "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + - "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -824,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -833,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -846,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -903,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -913,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1007,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1016,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1034,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1048,45 +1064,45 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -1094,27 +1110,27 @@ var regionTypes = [358]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1124,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1168,45 +1184,45 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1227,65 +1243,65 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 2014 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x61, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x63, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, @@ -1299,94 +1315,100 @@ var variantIndex = map[string]uint8{ "barla": 0x11, "basiceng": 0x12, "bauddha": 0x13, - "biscayan": 0x14, - "biske": 0x5c, - "bohoric": 0x15, - "boont": 0x16, - "bornholm": 0x17, - "cisaup": 0x18, - "colb1945": 0x19, - "cornu": 0x1a, - "creiss": 0x1b, - "dajnko": 0x1c, - "ekavsk": 0x1d, - "emodeng": 0x1e, - "fonipa": 0x64, - "fonkirsh": 0x65, - "fonnapa": 0x66, - "fonupa": 0x67, - "fonxsamp": 0x68, - "gascon": 0x1f, - "grclass": 0x20, - "grital": 0x21, - "grmistr": 0x22, - "hepburn": 0x23, - "heploc": 0x62, - "hognorsk": 0x24, - "hsistemo": 0x25, - "ijekavsk": 0x26, - "itihasa": 0x27, - "ivanchov": 0x28, - "jauer": 0x29, - "jyutping": 0x2a, - "kkcor": 0x2b, - "kociewie": 0x2c, - "kscor": 0x2d, - "laukika": 0x2e, - "lemosin": 0x2f, - "lengadoc": 0x30, - "lipaw": 0x5d, - "luna1918": 0x31, - "metelko": 0x32, - "monoton": 0x33, - "ndyuka": 0x34, - "nedis": 0x35, - "newfound": 0x36, - "nicard": 0x37, - "njiva": 0x5e, - "nulik": 0x38, - "osojs": 0x5f, - "oxendict": 0x39, - "pahawh2": 0x3a, - "pahawh3": 0x3b, - "pahawh4": 0x3c, - "pamaka": 0x3d, - "peano": 0x3e, - "petr1708": 0x3f, - "pinyin": 0x40, - "polyton": 0x41, - "provenc": 0x42, - "puter": 0x43, - "rigik": 0x44, - "rozaj": 0x45, - "rumgr": 0x46, - "scotland": 0x47, - "scouse": 0x48, - "simple": 0x69, - "solba": 0x60, - "sotav": 0x49, - "spanglis": 0x4a, - "surmiran": 0x4b, - "sursilv": 0x4c, - "sutsilv": 0x4d, - "tarask": 0x4e, - "tongyong": 0x4f, - "tunumiit": 0x50, - "uccor": 0x51, - "ucrcor": 0x52, - "ulster": 0x53, - "unifon": 0x54, - "vaidika": 0x55, - "valencia": 0x56, - "vallader": 0x57, - "vecdruka": 0x58, - "vivaraup": 0x59, - "wadegile": 0x5a, - "xsistemo": 0x5b, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 99 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1398,151 +1420,151 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1040 bytes, 260 elements -var likelyScript = [260]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 133: {lang: 0x3b, region: 0x11c}, - 134: {lang: 0xfd, region: 0xc4}, - 137: {lang: 0x27d, region: 0x106}, - 138: {lang: 0x2c9, region: 0x53}, - 139: {lang: 0x39f, region: 0x9c}, - 140: {lang: 0x39f, region: 0x53}, - 142: {lang: 0x3ad, region: 0xb0}, - 144: {lang: 0x1c6, region: 0x53}, - 145: {lang: 0x4fd, region: 0x9c}, - 198: {lang: 0x3cb, region: 0x95}, - 201: {lang: 0x372, region: 0x10c}, - 202: {lang: 0x420, region: 0x97}, - 204: {lang: 0x4ff, region: 0x15e}, - 205: {lang: 0x3f0, region: 0x99}, - 206: {lang: 0x45, region: 0x135}, - 207: {lang: 0x139, region: 0x7b}, - 208: {lang: 0x3e9, region: 0x99}, - 210: {lang: 0x3e9, region: 0x99}, - 211: {lang: 0x3fa, region: 0x99}, - 212: {lang: 0x40c, region: 0xb3}, - 215: {lang: 0x433, region: 0x99}, - 216: {lang: 0xef, region: 0xc5}, - 217: {lang: 0x43e, region: 0x95}, - 218: {lang: 0x44d, region: 0x35}, - 219: {lang: 0x44e, region: 0x9b}, - 223: {lang: 0x45a, region: 0xe7}, - 224: {lang: 0x11a, region: 0x99}, - 225: {lang: 0x45e, region: 0x53}, - 226: {lang: 0x232, region: 0x53}, - 227: {lang: 0x450, region: 0x99}, - 228: {lang: 0x4a5, region: 0x53}, - 229: {lang: 0x9f, region: 0x13e}, - 230: {lang: 0x461, region: 0x99}, - 232: {lang: 0x528, region: 0xba}, - 233: {lang: 0x153, region: 0xe7}, - 234: {lang: 0x128, region: 0xcd}, - 235: {lang: 0x46b, region: 0x123}, - 236: {lang: 0xa9, region: 0x53}, - 237: {lang: 0x2ce, region: 0x99}, - 240: {lang: 0x4ad, region: 0x11c}, - 241: {lang: 0x4be, region: 0xb4}, - 244: {lang: 0x1ce, region: 0x99}, - 247: {lang: 0x3a9, region: 0x9c}, - 248: {lang: 0x22, region: 0x9b}, - 250: {lang: 0x1ea, region: 0x53}, - 251: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { @@ -1557,1423 +1579,1423 @@ type likelyScriptRegion struct { // of the list in likelyLangList. // Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf8, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xce, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xe3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe5, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xec, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd8, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xea, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xec, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe6, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x90, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xfa, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xeb, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xe2, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xeb, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xeb, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe6, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc9, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf7, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8e, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xcd, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe8, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xca, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xeb, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd7, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xe3, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xe1, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe6, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xeb, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xec, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xeb, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xe4, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe6, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x91, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. // Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x85, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xcf, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x8b, flags: 0x0}, - 48: {region: 0x53, script: 0x8c, flags: 0x2}, - 49: {region: 0xba, script: 0xe8, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xd3, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { @@ -2987,306 +3009,306 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 2148 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xea, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } @@ -3298,38 +3320,38 @@ type likelyTag struct { // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3350,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3364,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3462,11 +3484,11 @@ type parentRel struct { // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 30244 bytes (29KiB); checksum: B6B15F30 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/internal/number/decimal.go b/vendor/golang.org/x/text/internal/number/decimal.go index 37e0c4b..e128cf3 100644 --- a/vendor/golang.org/x/text/internal/number/decimal.go +++ b/vendor/golang.org/x/text/internal/number/decimal.go @@ -419,7 +419,7 @@ func (d *Decimal) ConvertFloat(r RoundingContext, x float64, size int) { } } else { // TODO: At this point strconv's rounding is imprecise to the point that - // it is not useable for this purpose. + // it is not usable for this purpose. // See https://github.com/golang/go/issues/21714 // If rounding is requested, we ask for a large number of digits and // round from there to simulate rounding only once. diff --git a/vendor/golang.org/x/text/internal/number/tables.go b/vendor/golang.org/x/text/internal/number/tables.go index 0668a37..8efce81 100644 --- a/vendor/golang.org/x/text/internal/number/tables.go +++ b/vendor/golang.org/x/text/internal/number/tables.go @@ -1216,4 +1216,4 @@ var formats = []Pattern{Pattern{RoundingContext: RoundingContext{MaxSignificantD 0x0}, Flags: 0x0}} -// Total table size 8634 bytes (8KiB); checksum: BE6D4A33 +// Total table size 8634 bytes (8KiB); checksum: 8F23386D diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go index 289b3a3..4d9c661 100644 --- a/vendor/golang.org/x/text/language/language.go +++ b/vendor/golang.org/x/text/language/language.go @@ -344,7 +344,7 @@ func (t Tag) Parent() Tag { return Tag(compact.Tag(t).Parent()) } -// returns token t and the rest of the string. +// nextToken returns token t and the rest of the string. func nextToken(s string) (t, tail string) { p := strings.Index(s[1:], "-") if p == -1 { diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index ee45f49..1153baf 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -434,7 +434,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script or + // If deprecated codes match and there is no fiddling with the script // or region, we consider it an exact match. conf := Exact if language.AliasTypes[i] != language.Macro { diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 34a732b..a6573dc 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, - // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, + // Entry C0 - FF + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/text/message/catalog/go19.go b/vendor/golang.org/x/text/message/catalog/go19.go index 4e5e87f..291a4df 100644 --- a/vendor/golang.org/x/text/message/catalog/go19.go +++ b/vendor/golang.org/x/text/message/catalog/go19.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build go1.9 -// +build go1.9 package catalog diff --git a/vendor/golang.org/x/text/message/catalog/gopre19.go b/vendor/golang.org/x/text/message/catalog/gopre19.go index 9e14685..da44ebb 100644 --- a/vendor/golang.org/x/text/message/catalog/gopre19.go +++ b/vendor/golang.org/x/text/message/catalog/gopre19.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !go1.9 -// +build !go1.9 package catalog diff --git a/vendor/golang.org/x/text/number/option.go b/vendor/golang.org/x/text/number/option.go index de96f8e..eab1e3b 100644 --- a/vendor/golang.org/x/text/number/option.go +++ b/vendor/golang.org/x/text/number/option.go @@ -172,6 +172,6 @@ func Pad(r rune) Option { // - FormatPosition (using type aliasing?) // - Multiplier: find a better way to represent and figure out what to do // with clashes with percent/permille. -// - NumberingSystem(nu string): not accessable in number.Info now. Also, should +// - NumberingSystem(nu string): not accessible in number.Info now. Also, should // this be keyed by language or generic? // - SymbolOverrides(symbols map[string]map[number.SymbolType]string) Option diff --git a/vendor/modules.txt b/vendor/modules.txt index bb75a42..28ca43e 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -1,7 +1,3 @@ -# github.com/juju/go4 v0.0.0-20160222163258-40d72ab9641a -## explicit -# github.com/juju/persistent-cookiejar v1.0.0 -## explicit # github.com/r3labs/sse/v2 v2.10.0 ## explicit; go 1.13 github.com/r3labs/sse/v2 @@ -17,11 +13,13 @@ github.com/robertkrimen/otto/token # github.com/tylertravisty/go-utils v0.0.0-20230524204414-6893ae548909 ## explicit; go 1.16 github.com/tylertravisty/go-utils/random -# golang.org/x/net v0.0.0-20191116160921-f9c825593386 -## explicit; go 1.11 +# golang.org/x/net v0.24.0 +## explicit; go 1.18 golang.org/x/net/context -# golang.org/x/text v0.4.0 -## explicit; go 1.17 +golang.org/x/net/html +golang.org/x/net/html/atom +# golang.org/x/text v0.14.0 +## explicit; go 1.18 golang.org/x/text/feature/plural golang.org/x/text/internal golang.org/x/text/internal/catmsg @@ -38,10 +36,6 @@ golang.org/x/text/number # gopkg.in/cenkalti/backoff.v1 v1.1.0 ## explicit gopkg.in/cenkalti/backoff.v1 -# gopkg.in/errgo.v1 v1.0.1 -## explicit -# gopkg.in/retry.v1 v1.0.3 -## explicit; go 1.12 # gopkg.in/sourcemap.v1 v1.0.5 ## explicit gopkg.in/sourcemap.v1